KEGG   Ailuropoda melanoleuca (giant panda): 100476176Help
Entry
100476176         CDS       T01329                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 817 aa AA seqDB search
MRVKEPPKALPEKAKRSKRPAIPRDEDSSDDTAVGFTCQHVSHAISVNHVKKAVAENAWS
VCSECLKERRFCDGRPVLPSDIWLCLKCGFQGCGRNSESHHSLKHYKSWRTESHCITISL
STWVIWCYECDEKLSTQCNKKVLAQTVDFLQKHVSKAQTSTFSRILKLCEEKCETGEKRK
GRKGSSVPSVKGISNLGNTCFFNAVMQNLAQSYVLMELMNENKENGTKLKIFPSPDSQLD
PLIVELSSPGPLTSALLVFLHSMKETEKGPLSPKVLFNQLCQKAPRFKSFQQQDSQELLH
YLLDAVRTEETKRIQASILKAYNNPTTKTADDDTRKKVKAYGREGVKMNFIDRIFIGELT
STVMCEECANISSVNDPFIDISLPIIEERVSKPVLLGRMSKCRSLQVTDNSQYSDTVTIE
NTSQPGATKNQSSSKDKNQLVHGRKCIRKLSPGEDRAVVVPRKHENLDMNGDSSALASIV
NTESALTESPTDGSEKEASRSESSADADSEASESESASEQAVLLRSSRGCSVHPLAPSPQ
PLAAGPPTREAGRGDEGVAEAISVLYLSSPVPGDRDFDREKKPLNVPNRSCSSEEKHRLS
PRPQNAFQTLSQSYITTSKECSLQSCLYQFTSMELLMGNNKLLCENCTEKKQRSQKETGS
AEKKAEGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSA
TCKNVSVGDKVLYGLYGVVEHSGSMRGGHYTAYVKVRPPSRKLLEYITGKTYVPDVKEPD
SESAGQWVHVSDTCVQVVPESRALSAQAYLLFYERIL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagagcctcccaaagctttgcctgagaaagccaaaagaagtaaaaggcct
gctatacctcgtgatgaagactcttcagatgacactgctgtaggtttcacttgccagcat
gtaagtcatgctatcagtgtgaatcatgtgaagaaagcagtagctgagaatgcgtggtca
gtttgctcagaatgtttaaaagaaagaagattctgtgatgggcgaccagtacttccctct
gacatttggttgtgcctcaagtgtggttttcagggctgtggtagaaactcagaaagccat
cattccctgaagcactataagagttggagaacagaatctcattgtattacaattagtctg
agcacatgggttatatggtgttatgaatgtgatgaaaaattatcaacacagtgtaataag
aaggttttggctcaaacagttgattttctccagaaacatgtttctaaagcacaaacaagt
acattttctagaatcctaaaactttgtgaggaaaaatgtgaaacaggtgaaaaaaggaag
ggaagaaaaggcagcagtgtaccgtctgtgaaaggaatttcaaatttaggaaatacttgc
ttttttaatgcagtcatgcagaacttggcacaatcttacgttcttatggaactgatgaat
gagaacaaagaaaacgggacaaagctcaagatttttccttccccagactctcagctggac
ccattaatagtggaactttcaagccctggaccattgacctcagccttgttggtgtttctt
cacagcatgaaggagactgaaaaaggaccactttctcctaaagttctttttaatcagctt
tgtcagaaggcccctcgatttaaaagtttccagcaacaggacagtcaggagcttctgcat
tatctgctggatgcagtgaggacagaggaaacaaagagaatacaagctagcattctaaaa
gcatataacaacccaactactaaaactgctgatgatgatactagaaaaaaagtcaaagcg
tatggaagagaaggtgtgaaaatgaacttcatagatcggatctttattggtgaattaact
agcacagtcatgtgtgaagaatgtgcaaatatctcctcagtgaacgatccttttatcgat
atttcacttcctataatagaagaaagggtttcaaaacctgtacttttgggaagaatgagt
aaatgtagaagtttgcaagtgacagataatagtcagtacagtgacacggttactatagaa
aatacttctcaacccggagccaccaagaaccagtcttcatctaaagataagaatcaacta
gttcatggcagaaaatgtataagaaaattgtcacctggagaagatagagcagtcgtcgta
ccccggaaacatgagaaccttgacatgaacggggattcctcagcgttggcgagcatcgtg
aataccgagtcggctctgaccgaaagccccaccgacggcagtgagaaggaagccagccgt
tctgaaagcagtgccgatgcggacagcgaggcgtcagaatccgaaagcgcttctgagcag
gctgtgctgttgcggtcgagcagggggtgctcggtgcacccgctcgccccctctccccag
ccgctggcggctggaccacccaccagggaggctggccgaggtgatgagggagtggctgaa
gcgatttcggtactttatttgagcagccctgtacctggagacagagattttgatagagaa
aagaagccactaaatgttccaaatcgttcatgttcttcagaggagaagcataggttgtct
cctcgcccccaaaatgcttttcagaccctttctcagagctacataaccacttctaaagaa
tgctcacttcagtcctgtctctaccagtttacatctatggaattactaatggggaataat
aagcttctttgtgagaattgtactgaaaagaaacagaggtcccaaaaggaaaccggttct
gcagaaaagaaagcagaaggggtttacactaatgccaggaagcaattgctcatttctgct
gttccagctatcctaattctccatcttaaaagattccatcaggctggcttgagtcttcga
aaagtaaacagacatgtggattttccacttatgcttgatttagcaccgttctgttctgct
acttgtaagaatgtaagtgtgggagataaagttctctatggtctctatggcgtagtggaa
catagtggctcaatgagaggaggtcactacacggcttatgtgaaagtgagaccaccctcc
aggaaattattggagtatatcactggaaagacatatgtacctgatgtgaaagaacctgac
agtgagtcggcaggccagtgggtccacgttagtgacacttgtgtgcaagtggttccagaa
tcaagagcacttagtgcacaagcataccttcttttttatgaaagaatattataa

DBGET integrated database retrieval system