KEGG   Ailuropoda melanoleuca (giant panda): 100476267Help
Entry
100476267         CDS       T01329                                 

Definition
lysosomal thioesterase PPT2-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aml01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aml00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aml04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 309 aa AA seqDB search
MKSCGSMLGLGGLRLPPAGILLLLPFLPPLLLPAAPAPHRASYKPVIVVHGLFDSSYSFR
HLLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFGEAVAPIMAKAPEGVHLICYSQG
GLVCRALLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEF
SICNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITP
WQSSFFGFYDANETVLEMEEQAVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLY
ETCIEPWLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctcggccttggggggctgcggctccccccggcggggatc
ctgctcctgttgcctttcctgccgccgctgctgctgcccgcagcccccgcgccccatcgc
gcttcctacaaaccggtcatcgtggtgcacgggctctttgacagctcatacagcttccgc
cacctgctggaatacatcaacgagacacaccctgggactgtggtgacagtgctcgatctc
ttcgatgggagagagagcttgcgacccttgtgggagcaggtgcaagggtttggagaggct
gtggcccccatcatggcaaaggcccctgagggggtgcatctcatctgctactcgcaggga
ggtctggtgtgccgggccctgctctctgtcatggatgagcacaatgtggattccttcatc
tctctctcctctccacaaatgggacagtatggagatacggactatttgaagtggctcttc
cctacctccatgaggtctaacctctaccggatctgctatagcccctggggccaggaattc
tccatctgcaactactggcacgacccccaccatgatgacttgtacctcaatgccagtagc
ttcctggctctgatcaatggggaaagagatcatcccaatgccactgcgtggaggaagaac
tttcttcgtgtgggccgcctggtgctgattgggggccctgatgatggtgttattaccccc
tggcagtctagcttctttggtttctatgacgcaaatgaaacggtcctggagatggaggag
caagcggtttatctgcgggattcttttggcttgaagaccctcttggcccggggagccata
gtgaggtgtccgatggctgggatctcccacacggcctggcactccaaccgtaccctatat
gagacctgcattgaaccttggctctcctga

DBGET integrated database retrieval system