KEGG   Ailuropoda melanoleuca (giant panda): 100476326Help
Entry
100476326         CDS       T01329                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml04512  ECM-receptor interaction
aml05020  Prion diseases
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05165  Human papillomavirus infection
aml05200  Pathways in cancer
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100476326 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100476326 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100476326 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100476326 (LAMC1)
   05222 Small cell lung cancer
    100476326 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    100476326 (LAMC1)
  Infectious diseases
   05165 Human papillomavirus infection
    100476326 (LAMC1)
   05146 Amoebiasis
    100476326 (LAMC1)
   05145 Toxoplasmosis
    100476326 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 100476326
NCBI-ProteinID: XP_011228909
Ensembl: ENSAMEG00000002289
UniProt: D2HN94
Position
Un
AA seq 1580 aa AA seqDB search
AGCARAAMDECTDEGGRSQRCMPEFVNAAFNVTVVATNTCGAPPEEYCVQTGVTGVTKSC
HLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVR
LKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEF
SDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKV
LKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWR
RATAESASECLPCECNGQSQECYFDPELYRSTGHGGHCTNCQGNTDGANCERCRENFFRL
GNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGYHSLTEAGCRPCSCNP
SGSIDECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVG
YSVYPITSTFQIDEDGWHVEQRDGSEASLEWSSARQDITVISDSYFPRYFVAPAKFLGKQ
VFSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHE
ATDYPWRPPLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTSARPGPGVPATWVES
CTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCDCRDNTAGP
HCERCGDGYYGDSTSGSSSDCQPCPCPGGSSCAVVPKTQEVVCTSCPTGTTGKRCELCDD
GYFGDPLGENGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFF
GNPLAPNPADKCKACACSPYGTAKQQSGCNPVTGQCECLPHVTGRDCGACDPGFYNLQSG
QGCERCDCHALGSTSGQCDIRTGQCECQPGVTGQHCERCEVNHFGFGPEGCKPCDCHSEG
SLSLQCKDDGRCECKQGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKL
QELENLIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLIDRLQRVNNT
LSSQISRLQNIRNTIEETGNLAEQARARVESTEQLIEIATRELEKAKIAVANVSITQPES
TGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANETSTEAFNLLLRTLAGENQTALEI
EELNRKYEQAKNMSQDLEKQAARVHEEAKRAGDKAVEIYASVAQLTPVDSEALENEANKI
KKEAEDLDRLIDQKLKDYEDLREDMRGKELEVKKLLEKGKTEQQTADQLLARADAAKALA
EEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEDALRRIPAINQTIIEANEKTREAQ
LALGSAAADATEAKSKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNSMLKQLQ
EAEQELKRKQEDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLHLINDLLEQLGQLDT
VDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIVDYNRDIEEITKDIRNL
EDIKKTLPSGCFNTPSIEKP
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
gccggctgcgcccgggcagccatggacgagtgcacggacgagggcgggcggtcgcagcgc
tgcatgcccgagttcgtcaacgccgccttcaacgtgaccgtggtggccaccaacacgtgc
ggggctccgcccgaggagtactgtgtgcagaccggggtgaccggggtcaccaagtcctgt
cacctgtgcgacgccgggcagccccacctgcagcacggggcagccttcttgaccgactac
aacaaccaggccgacaccacctggtggcaaagccagaccatgctggccggggtgcagtac
cccaactccatcaacctcacgctgcacctgggaaaagcttttgacatcacatacgtgcgc
ctgaagttccacaccagccgccccgagagcttcgccatttacaagcgcacgcgggaagat
gggccctggattccttaccagtactacagcggctcctgcgagaacacctactcgaaggca
aaccgcggcttcatcaggacaggaggagacgagcagcaggccttgtgcacagatgaattc
agtgacatttcccctctaactgggggcaacgtggccttttcaacactagaaggaaggccc
agcgcctacaactttgacaacagccctgtgctgcaggaatgggtaactgccaccgacatc
cgagtaactctcaatcgcctgaacacctttggagatgaagtgtttaacgaccccaaagtt
ctcaagtcctattattatgcaatctctgattttgctgtgggtggtaggtgtaaatgcaac
gggcatgcaagtgagtgtgtgaagaatgaatttgacaagctggtgtgtaattgcaaacat
aatacttacggggtagactgtgaaaagtgtctgcctttcttcaacgaccggccgtggagg
agggcaactgccgagagcgccagcgaatgcctgccctgtgagtgtaatggccaatcacag
gagtgctactttgaccccgaactgtaccggtccaccggccacggcggccactgtaccaac
tgccagggtaacacagatggcgccaactgcgagagatgccgggagaatttcttccgcctt
gggaacaacgaagcctgctctccctgtcactgtagtcctgtgggttctctcagcacacag
tgtgatagctatggtaggtgtagctgcaagccgggcgtgatgggggataagtgtgaccgt
tgccagcccggataccattctctcacggaggcagggtgcaggccatgctcttgtaatccc
tctggcagcatagatgaatgtaatgttgaaacaggaagatgtgtttgcaaagacaacgtt
gaaggctttaattgtgagagatgcaaacctggattttttaatctggaatcatctaatcct
aggggttgcacaccctgcttctgctttgggcattcttctgtctgtacaaatgctgttggc
tacagtgtttatcctataacctctacctttcagatcgatgaagacgggtggcatgtggaa
caaagggacggctctgaagcgtcactcgagtggtcctctgcgaggcaggatatcaccgtc
atctcagatagctactttcctaggtacttcgttgcccctgcgaagttcttgggcaagcag
gtgttcagttatggtcagaacctctccttctcctttcgcgtggacaggcgagacactcgc
ctctccgcagaagacctggtgcttgagggagctggcctgagagtgtctgtgcccttgatc
gctcagggcaattcctatccgagtgagaccactgtgaagtatgtcttcaggctccatgaa
gccacagattacccttggaggcctcctcttacccctttcgaatttcagaagctcctaaac
aatttgacctctatcaaaatccgtgggacgtatagtgagagaagtgccggatatctggat
gatgtcaccctaacgagtgctcgcccggggcccggggtgcctgccacttgggtggagtcc
tgcacctgtcctgtgggatacggagggcagttttgtgagatgtgcctctcgggttacaga
agagaaactccgagtcttggaccgtacagcccgtgtgtgctttgtacctgcaatggacac
agtgagacctgtgaccccgagacaggtgtgtgtgactgcagagacaacacagccggcccc
cactgtgagaggtgcggcgatgggtactatggcgattccacctcgggcagctcgtccgac
tgccagccctgcccgtgccctgggggctcgagctgcgccgtcgtcccgaagacgcaggag
gtggtgtgcaccagctgtcctaccggcaccaccggtaaaaggtgtgagctctgtgatgat
ggctactttggagaccctctgggtgaaaacggccctgtgagactttgccgcctttgtcaa
tgcaatgacaacatcgaccccaatgcggttggaaattgcaatcgcttgacaggagaatgc
ctgaaatgcatctataacactgctggcttctactgtgaccgatgcaaagatggatttttt
ggaaatcccctggctcccaatccagcagacaaatgcaaagcctgtgcgtgcagtccctac
ggaaccgcgaagcagcagagcggctgtaaccctgtgaccgggcagtgcgaatgtctgccc
cacgtgaccggccgggactgtggagcctgtgaccctggattctacaacctgcagagtggg
cagggctgtgagaggtgtgactgccatgcgttgggttctaccagtggacagtgtgacatc
cgcactggccagtgtgagtgccagcctggcgtcacgggccagcactgtgagcgctgtgag
gtcaaccactttgggtttggacccgaaggctgcaaaccctgtgactgtcattctgaggga
tctctctcactccagtgcaaagatgatggtcgatgtgaatgtaaacagggttttgtggga
aatcgctgtgaccagtgtgaagagaactatttctacaatcggtcttggcctggctgccag
gagtgtccagcatgttaccggctggtaaaggataaggttgctgatcatcgagtgaaactc
caggaattagagaacctcatagcaaaccttggaactggggaagaggtggtgacagatcaa
gcctttgaggacagactaaaggaagcagagagagaagttatggacctccttcgagaggcc
caggatgtcaaagatgtagaccagaatttgatagaccgcctccagagagtgaataacacc
ttatccagccaaattagccgtttacagaatatccgcaataccattgaggagactggaaac
ttggctgagcaagcacgtgccagggtggaaagcacagagcagttgattgaaatcgcgacc
cgagaacttgagaaagcaaagattgctgttgccaacgtgtcaatcactcagccagagtct
acaggggacccaaacaacatgactcttctggcagaagaggcacgaaagcttgctgaacga
cataaacaagaagctgatgatattgtaagagtggcaaagacagctaatgagacatcaact
gaagcatttaatctgcttctgagaacactggcaggagaaaatcaaacagcacttgagatt
gaagagcttaatagaaagtatgaacaagcgaagaacatgtcacaggacctggagaagcaa
gctgcccgggtacacgaggaggccaagagggctggagataaagcggtggagatctatgcc
agcgttgcccagctgacgcccgtggactcggaagctctggagaatgaggctaataaaatc
aagaaggaagctgaagatctggaccgtctgattgaccagaaattgaaagattatgaggac
ctcagagaagacatgagggggaaggaacttgaagtcaagaagcttctggagaagggaaag
accgaacagcagactgctgaccagcttctagcccgggcagatgccgccaaggctcttgca
gaagaagctgcaaaaaagggacgaaacaccttacaagaagccaatgacattctcaacaac
ctgaaggacttcgacaggcgagtgaacgataacaagaccgccgcagaggacgctttaagg
agaatccctgccatcaaccagaccataatcgaagccaatgaaaagacgagggaggcgcag
ctggcgctgggcagtgctgccgcggacgccaccgaagccaagagcaaggcccatgaggcg
gagaggatcgccagcgccgtccagaagaacgctaccagcaccaaggcagaggccgaaagg
acttttgcagaagttacagacctggataacgaggtgaacagtatgctgaaacagctacag
gaagcagaacaggaactgaagagaaaacaagaggacgccgaccaggatatgatgatggca
gggatggcttcacaggctgctcaggaagccgagatcaatgccagaaaggccaaaaactcc
gtgaccagcctcctccacctgattaatgaccttctggagcagctggggcagctggacaca
gtagacctgaacaagctcaatgagatcgaaggcaccctgaacaaagccaaagatgaaatg
aaagtcagtgatctcgacaggaaagtgtctgatttggagaatgaagccaggaagcaggag
gccgccatcgtggactataacagagacatcgaggagatcacgaaggacattcgcaacctg
gaagacatcaagaagaccttaccatctggctgcttcaacaccccgtccatcgaaaagccc
tag

DBGET integrated database retrieval system