KEGG   Ailuropoda melanoleuca (giant panda): 100476326Help
Entry
100476326         CDS       T01329                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100476326 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100476326 (LAMC1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100476326 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100476326 (LAMC1)
   05222 Small cell lung cancer
    100476326 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    100476326 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    100476326 (LAMC1)
   05145 Toxoplasmosis
    100476326 (LAMC1)
Cell adhesion molecules and their ligands [BR:aml04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      100476326 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      100476326 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      100476326 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      100476326 (LAMC1)
   VLA-3
      100476326 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      100476326 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      100476326 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      100476326 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      100476326 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      100476326 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      100476326 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1653 aa AA seqDB search
MENKKAGGNYYIKGKNMDCRAPTIRSLGSRPQGAAGWTQLLTPGGAEIRAAATQVGAGPK
GRFQXXXXXXXXXAGCARAAMDECTDEGGRSQRCMPEFVNAAFNVTVVATNTCGAPPEEY
CVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLT
LHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRT
GGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRL
NTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVDC
EKCLPFFNDRPWRRATAESASECLPCECNGQSQECYFDPELYRSTGHGGHCTNCQGNTDG
ANCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGYHS
LTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCF
CFGHSSVCTNAVGYSVYPITSTFQIDEDGWHVEQRDGSEASLEWSSARQDITVISDSYFP
RYFVAPAKFLGKQVFSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYP
SETTVKYVFRLHEATDYPWRPPLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTSA
RPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPE
TGVCDCRDNTAGPHCERCGDGYYGDSTSGSSSDCQPCPCPGGSSCAVVPKTQEVVCTSCP
TGTTGKRCELCDDGYFGDPLGENGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNT
AGFYCDRCKDGFFGNPLAPNPADKCKACACSPYGTAKQQSGCNPVTGQCECLPHVTGRDC
GACDPGFYNLQSGQGCERCDCHALGSTSGQCDIRTGQCECQPGVTGQHCERCEVNHFGFG
PEGCKPCDCHSEGSLSLQCKDDGRCECKQGFVGNRCDQCEENYFYNRSWPGCQECPACYR
LVKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDVD
QNLIDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARARVESTEQLIEIATRELEKAK
IAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANETSTEAFNLLL
RTLAGENQTALEIEELNRKYEQAKNMSQDLEKQAARVHEEAKRAGDKAVEIYASVAQLTP
VDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKELEVKKLLEKGKTEQQTAD
QLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEDALRRIPAINQ
TIIEANEKTREAQLALGSAAADATEAKSKAHEAERIASAVQKNATSTKAEAERTFAEVTD
LDNEVNSMLKQLQEAEQELKRKQEDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLHL
INDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIVDYN
RDIEEITKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 4962 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaaaaggctggtggaaattattacattaaaggtaaaaacatggactgcaga
gctcccaccatcaggtccctcgggtcccggccccagggcgcggccggctggacgcaacta
ctgacacctggtggggcggagatccgcgctgccgcgacccaggttggcgcggggcccaaa
ggccgattccaannnnnnnnnnnnnnnnnnnnnnnnncggccggctgcgcccgggcagcc
atggacgagtgcacggacgagggcgggcggtcgcagcgctgcatgcccgagttcgtcaac
gccgccttcaacgtgaccgtggtggccaccaacacgtgcggggctccgcccgaggagtac
tgtgtgcagaccggggtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcag
ccccacctgcagcacggggcagccttcttgaccgactacaacaaccaggccgacaccacc
tggtggcaaagccagaccatgctggccggggtgcagtaccccaactccatcaacctcacg
ctgcacctgggaaaagcttttgacatcacatacgtgcgcctgaagttccacaccagccgc
cccgagagcttcgccatttacaagcgcacgcgggaagatgggccctggattccttaccag
tactacagcggctcctgcgagaacacctactcgaaggcaaaccgcggcttcatcaggaca
ggaggagacgagcagcaggccttgtgcacagatgaattcagtgacatttcccctctaact
gggggcaacgtggccttttcaacactagaaggaaggcccagcgcctacaactttgacaac
agccctgtgctgcaggaatgggtaactgccaccgacatccgagtaactctcaatcgcctg
aacacctttggagatgaagtgtttaacgaccccaaagttctcaagtcctattattatgca
atctctgattttgctgtgggtggtaggtgtaaatgcaacgggcatgcaagtgagtgtgtg
aagaatgaatttgacaagctggtgtgtaattgcaaacataatacttacggggtagactgt
gaaaagtgtctgcctttcttcaacgaccggccgtggaggagggcaactgccgagagcgcc
agcgaatgcctgccctgtgagtgtaatggccaatcacaggagtgctactttgaccccgaa
ctgtaccggtccaccggccacggcggccactgtaccaactgccagggtaacacagatggc
gccaactgcgagagatgccgggagaatttcttccgccttgggaacaacgaagcctgctct
ccctgtcactgtagtcctgtgggttctctcagcacacagtgtgatagctatggtaggtgt
agctgcaagccgggcgtgatgggggataagtgtgaccgttgccagcccggataccattct
ctcacggaggcagggtgcaggccatgctcttgtaatccctctggcagcatagatgaatgt
aatgttgaaacaggaagatgtgtttgcaaagacaacgttgaaggctttaattgtgagaga
tgcaaacctggattttttaatctggaatcatctaatcctaggggttgcacaccctgcttc
tgctttgggcattcttctgtctgtacaaatgctgttggctacagtgtttatcctataacc
tctacctttcagatcgatgaagacgggtggcatgtggaacaaagggacggctctgaagcg
tcactcgagtggtcctctgcgaggcaggatatcaccgtcatctcagatagctactttcct
aggtacttcgttgcccctgcgaagttcttgggcaagcaggtgttcagttatggtcagaac
ctctccttctcctttcgcgtggacaggcgagacactcgcctctccgcagaagacctggtg
cttgagggagctggcctgagagtgtctgtgcccttgatcgctcagggcaattcctatccg
agtgagaccactgtgaagtatgtcttcaggctccatgaagccacagattacccttggagg
cctcctcttacccctttcgaatttcagaagctcctaaacaatttgacctctatcaaaatc
cgtgggacgtatagtgagagaagtgccggatatctggatgatgtcaccctaacgagtgct
cgcccggggcccggggtgcctgccacttgggtggagtcctgcacctgtcctgtgggatac
ggagggcagttttgtgagatgtgcctctcgggttacagaagagaaactccgagtcttgga
ccgtacagcccgtgtgtgctttgtacctgcaatggacacagtgagacctgtgaccccgag
acaggtgtgtgtgactgcagagacaacacagccggcccccactgtgagaggtgcggcgat
gggtactatggcgattccacctcgggcagctcgtccgactgccagccctgcccgtgccct
gggggctcgagctgcgccgtcgtcccgaagacgcaggaggtggtgtgcaccagctgtcct
accggcaccaccggtaaaaggtgtgagctctgtgatgatggctactttggagaccctctg
ggtgaaaacggccctgtgagactttgccgcctttgtcaatgcaatgacaacatcgacccc
aatgcggttggaaattgcaatcgcttgacaggagaatgcctgaaatgcatctataacact
gctggcttctactgtgaccgatgcaaagatggattttttggaaatcccctggctcccaat
ccagcagacaaatgcaaagcctgtgcgtgcagtccctacggaaccgcgaagcagcagagc
ggctgtaaccctgtgaccgggcagtgcgaatgtctgccccacgtgaccggccgggactgt
ggagcctgtgaccctggattctacaacctgcagagtgggcagggctgtgagaggtgtgac
tgccatgcgttgggttctaccagtggacagtgtgacatccgcactggccagtgtgagtgc
cagcctggcgtcacgggccagcactgtgagcgctgtgaggtcaaccactttgggtttgga
cccgaaggctgcaaaccctgtgactgtcattctgagggatctctctcactccagtgcaaa
gatgatggtcgatgtgaatgtaaacagggttttgtgggaaatcgctgtgaccagtgtgaa
gagaactatttctacaatcggtcttggcctggctgccaggagtgtccagcatgttaccgg
ctggtaaaggataaggttgctgatcatcgagtgaaactccaggaattagagaacctcata
gcaaaccttggaactggggaagaggtggtgacagatcaagcctttgaggacagactaaag
gaagcagagagagaagttatggacctccttcgagaggcccaggatgtcaaagatgtagac
cagaatttgatagaccgcctccagagagtgaataacaccttatccagccaaattagccgt
ttacagaatatccgcaataccattgaggagactggaaacttggctgagcaagcacgtgcc
agggtggaaagcacagagcagttgattgaaatcgcgacccgagaacttgagaaagcaaag
attgctgttgccaacgtgtcaatcactcagccagagtctacaggggacccaaacaacatg
actcttctggcagaagaggcacgaaagcttgctgaacgacataaacaagaagctgatgat
attgtaagagtggcaaagacagctaatgagacatcaactgaagcatttaatctgcttctg
agaacactggcaggagaaaatcaaacagcacttgagattgaagagcttaatagaaagtat
gaacaagcgaagaacatgtcacaggacctggagaagcaagctgcccgggtacacgaggag
gccaagagggctggagataaagcggtggagatctatgccagcgttgcccagctgacgccc
gtggactcggaagctctggagaatgaggctaataaaatcaagaaggaagctgaagatctg
gaccgtctgattgaccagaaattgaaagattatgaggacctcagagaagacatgaggggg
aaggaacttgaagtcaagaagcttctggagaagggaaagaccgaacagcagactgctgac
cagcttctagcccgggcagatgccgccaaggctcttgcagaagaagctgcaaaaaaggga
cgaaacaccttacaagaagccaatgacattctcaacaacctgaaggacttcgacaggcga
gtgaacgataacaagaccgccgcagaggacgctttaaggagaatccctgccatcaaccag
accataatcgaagccaatgaaaagacgagggaggcgcagctggcgctgggcagtgctgcc
gcggacgccaccgaagccaagagcaaggcccatgaggcggagaggatcgccagcgccgtc
cagaagaacgctaccagcaccaaggcagaggccgaaaggacttttgcagaagttacagac
ctggataacgaggtgaacagtatgctgaaacagctacaggaagcagaacaggaactgaag
agaaaacaagaggacgccgaccaggatatgatgatggcagggatggcttcacaggctgct
caggaagccgagatcaatgccagaaaggccaaaaactccgtgaccagcctcctccacctg
attaatgaccttctggagcagctggggcagctggacacagtagacctgaacaagctcaat
gagatcgaaggcaccctgaacaaagccaaagatgaaatgaaagtcagtgatctcgacagg
aaagtgtctgatttggagaatgaagccaggaagcaggaggccgccatcgtggactataac
agagacatcgaggagatcacgaaggacattcgcaacctggaagacatcaagaagacctta
ccatctggctgcttcaacaccccgtccatcgaaaagccctag

DBGET integrated database retrieval system