KEGG   Ailuropoda melanoleuca (giant panda): 100476428Help
Entry
100476428         CDS       T01329                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 523 aa AA seqDB search
MVSRPEPESEAMDAELTPPGCSHLSSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCV
CHVCGIHLNRLHSCLHCVFFGCFTKKHIHEHAKSKRHRLAIELMYGGIYCFLCQDYIYDK
DMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLINLG
NTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPY
KLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFT
GGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGSVVNGESHVAGTTTL
TDCLRRFTRPEHLGSGAKIKCSGCHSYQESTKQLTMKKVPIVACFHLKRFEHSAKLRRKI
TTYVSFPLELDMTPFMASSKESRMNGQYQQLTDSLNNDNKYSLFAVVNHQGTLESGHYTS
FIRQHKDQWFKCDDAIITKASIEDVLDSEGYLLFYHKQFLEYE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggtctcccggcccgagccggagagcgaggccatggacgcggagctgacgccgccgggc
tgctcgcacctgagcagcttcaaggtggacaactggaagcagaacctgcgggccatctac
cagtgcttcgtgtggagcggcacggcggaggcccgcaagcgcaaggcgaagtcgtgcgtg
tgccacgtgtgcggcatacacctgaacaggctccactcctgcctgcactgtgtcttcttt
ggctgcttcaccaagaaacatatccacgaacacgcgaagtccaagcggcacaggttggcc
atagagcttatgtatggcggcatctactgctttttgtgtcaggactacatatatgacaaa
gacatggaaatcattgccaaagaggagcaacggaaagcttggaaaatgcaaggtgttggg
gagaagttttcaacttgggaacccaccaaacgggagcttgaactgctgaaacacaacccg
aaaaggcgaaagatcacctccaactgcaccatcgggctgcgggggctgatcaacctggga
aacacctgcttcatgaactgcatcgtccaggccctcacccacacgccgcttctgcgagac
ttcttcctctccgaccggcacaggtgtgagatgcagagccccagctcgtgtctggtctgc
gagatgtcctcgctttttcaggagttctactcggggcaccgctccccgcacatcccgtac
aagttgctgcacctggtgtggactcacgcacggcacctggcggggtacgagcagcaggac
gcgcacgagttcctcatcgccgccctggacgtcctgcaccggcactgcaaaggtgacgat
aatgggaagaaggccaacaaccccaaccactgcaactgcatcatagaccagatcttcacg
ggcgggctgcagtcggacgtcacctgccaagtctgccacggagtctctaccaccatagac
cccttctgggacatcagtttggatctgcctggctcttccaccccgttctggcccctgagc
cccgggagtgagggcagcgtggtgaacggggaaagccacgtagcgggaaccacgacgctt
acggactgcttgcgaaggtttaccagacccgagcacttaggaagcggtgcgaagatcaaa
tgcagcggctgccatagctaccaggagtccacgaagcagcttaccatgaagaaagtgccc
atcgtagcctgtttccacctcaaacgattcgaacactcggccaaactgagacggaagatc
accacgtacgtgtccttccccctggaactggacatgacccccttcatggcgtccagcaaa
gagagcaggatgaatggacagtaccagcagctaacggacagtctcaacaatgacaataag
tactccctgtttgccgtagttaaccaccaagggaccctggagagcggccactacaccagc
ttcatccggcagcacaaggaccagtggttcaagtgcgacgatgccatcatcaccaaggcc
agcatcgaggacgtgctggacagtgaggggtacctgctgttctaccacaagcagttcctg
gagtacgagtag

DBGET integrated database retrieval system