KEGG   Ailuropoda melanoleuca (giant panda): 100476459Help
Entry
100476459         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 11-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100476459
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100476459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 952 aa AA seqDB search
MAAAPWLFGGLCFRFRDQNPEVDVEGXLFLSPAAVAERGGRTVMAAVAANVAAAAENREP
RREAVPGLESQRRQVENGESGRERPLRAGESWFLVEQHWYKQWEVYVQGGDQDSGTFPGC
INNADLFEDQVNWRLKKGLVEGEDYVLLPAAAWHCLVDWYGLEHGQPPIERKVVELPSVQ
KVEVYPVELLLVRHSDMDTPHTAQFSHTDSVDLVLRTAREQFLVSPQEETRLWIKNAEGS
FERLCNTRVTVLDAALKSGQVVIMETRNKDGTWPSAQPQAVNTALEEDEEFQGQPGICGL
TNLGNTCFMNSALQCLSNVPQLTEYFLKNRYLEELNFCNPLGMKGEIAEAYADLVKQAWS
GHPXXXXXXXXQTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAA
GRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVS
HKRVMEVFFVSMDPRRKPEQHRLVVPKKGKISDLCVALAKHTGMSPERMMVADVFSHRFY
KIYQLEESLSSILDRDDIFIYEVSGRSAIGENSREDVVLPIYLRERTPARDYNNSYYGLM
LFGHPLLVSVPRDRLSWDALYHILLYRLSRYVTRPSSDDEDDGDEKDMEDKDNIPKPGHV
AGGSSQNSGPEQAGPSSGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQTVNSNGTSDRS
TFNEDTHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVRLQECIELFTTV
ETLEKENPWYCPTCKQQQLATKKLDLWTLPETLIIHLKRFSYTKFSREKLDTLVEFPIRD
LDFSEFVIKPQNESAPELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQWHYFDDNSVSP
VTENQIESKAAYVLFYQRQDVARRLQPQPGLSDPPASPACGSPSNSEFMDVN
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccccctggctgtttggggggctctgtttccgtttccgggaccagaatccg
gaagtggacgttgaggggngcctcttcctatctccagctgcagtagctgagagaggaggg
cgaacggtgatggcggcggtcgcggcgaatgtggcggctgcggccgagaaccgagagccg
cgacgcgaagcggtgccgggccttgagagccagcggcgccaggtcgagaacggcgagagt
gggcgagagcgtccattgcgggccggcgaaagctggttcctcgtggagcagcactggtac
aaacagtgggaagtgtacgtgcagggaggagaccaggactccggcaccttccctggctgc
atcaataatgctgacctctttgaagaccaggtaaactggcgcctcaagaagggtctggtg
gaaggtgaggactatgttctgctcccagccgctgcttggcattgcctggtcgactggtat
ggtctagagcatggccagccacccattgaacgcaaggttgtggagctgcccagcgtccag
aaggtcgaagtgtacccagtagaactgctgcttgtccggcacagtgatatggacacacct
cacactgctcagttcagccatacagattctgttgatctcgttctgcgcaccgcccgagag
cagtttctggtgagtccccaggaagagacacgcctgtggatcaagaacgctgagggttct
tttgagagattgtgcaacacccgcgtcacagtgctcgacgctgccctcaagagtgggcag
gtggtcatcatggagacccgaaacaaggatggcacgtggcccagtgcccagccacaggcc
gtgaacactgcgttggaggaggatgaggagttccagggccagccaggcatctgtggtctc
accaacctgggcaacacgtgcttcatgaactcggccctgcagtgcctcagtaatgtgcca
cagctcacggagtacttcctcaagaaccgctacctggaggagctcaacttctgcaacccg
ctgggcatgaagggtgagattgcggaggcctatgctgacctggtgaagcaggcctggtcc
ggccacccnnnnnnnnnnnnnnnnnnnnnnngtcagaccaaggtcggccactttgcgtcc
cagtttctgggctaccagcagcacgactcacaggagctgctgtcgttcctcctggatgga
ctgcacgaggacctcaatcgtgtcaagaagaaggagtatgtggagctgtgtgatgctgct
gggcggccagatcaggaggtcgctcaggaggcctggcagaaccacaaacgtcggaacgat
tctgtgattgtggacactttccacggtctcttcaagtccacgctggtgtgccctgattgt
ggcaacgtgtctgtgaccttcgaccccttctgctacctcagtgtgccactgcctgtcagc
cacaagagggtcatggaggtcttctttgtctccatggaccctcgccgcaagccagagcag
catcggctcgtggtccccaagaaaggcaagatctccgatctgtgtgtggctctggccaag
cacactggcatgtcgcctgagaggatgatggtggctgatgtcttcagtcaccgcttctat
aaaatctaccagctagaggagtctctgagcagcatcttggaccgagatgatattttcata
tacgaggtgtcaggcaggtctgctattggcgagaactccagggaggacgtcgtgcttcct
atctacctgcgggagcgcaccccagcccgggactacaacaactcctactatggcctgatg
ctctttgggcaccctctcctggtgtcggtgccccgtgaccggctctcctgggacgccctc
tatcacatcctgctctaccgcctctcgcgctatgtgaccagacctagctcggatgacgaa
gatgacggggatgagaaagacatggaggataaggacaacatccccaagcctggacatgtg
gctgggggcagctcccaaaattctgggccggagcaggcagggcctagctccggagtcgca
ggcgggagccgggcccccgtggacaactcccctggaccatctcactggccccagagggcg
cggcgcaagcacctgttcaccctgcagacagtgaactccaacgggaccagcgaccgctcg
accttcaacgaggatacccatgcccagccgtacattgccatcgactgggagccagagatg
aagaagcgttactatgacgaggtggaggcggagggctacgtgaagcatgactgcgtcggg
tacgtgctgaagaaggctccggtgcggctgcaggaatgcattgagctcttcaccactgtc
gagactctggagaaggaaaatccctggtactgccccacctgcaagcagcagcagctggcc
accaagaagctggacctgtggacactgcccgagacgctcatcatccacctgaagcgcttc
tcctacaccaagttctcccgcgagaagctggacacccttgtggagttccccatccgggac
ctggacttctctgagtttgtcatcaagccgcagaacgagtccgcaccagagctgtacaaa
tacgatctcatcgcggtttccaaccattatgggggcctgcgtgacggacactacacgaca
tttgcctgcaacaaggacagtggccagtggcactacttcgatgacaacagcgtctcacct
gtaactgagaaccagattgagtccaaggcggcctatgttctcttctaccaacgccaggat
gtggcgcgtcgcctgcagccccagcccggcttatctgaccccccagcatcccctgcctgt
ggttccccatccaactctgagttcatggatgtaaactga

DBGET integrated database retrieval system