KEGG   Ailuropoda melanoleuca (giant panda): 100476506Help
Entry
100476506         CDS       T01329                                 

Gene name
USP48, USP31
Definition
ubiquitin specific peptidase 48
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1228 aa AA seqDB search
XXXXXXXXRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQPVGRGTQG
QGEVTEQLAHLVRALWTLEYTPQHSRDFKSIVSKNALQYRGNSQHDAQEFLLWLLDRVHE
DLNHAVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQELFQAQYRSSLTCPHCQKQSNTF
DPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLREAVSMETKIPTD
QIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNSNLNHL
KFALDHRLSSMQAAAKQGKIDLPPTRAENDKIVLLVCNRACTGQQGKRFGLPFVLHLEKT
IAWDLLQKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEKPLCHPTVERALK
SCGPGGTAHVKLVVEWDKETKDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQCFQL
YTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRVKLQNMVKF
PLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYVYDLYAVCNHHGTMQGGHY
TAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSS
LCEHWVSRLPGSKQASVTSAASSRRTSLASLSESVEMAGERSEDDGGFSTRPFVRSVQRQ
SLSSRSSVTSPLAVNDNCIRPSWSLSAKLQMRSSSPSRFSGDSPIHTSASTLEKIGEAVD
DKVSISCFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFRDESDTRKLNSSVID
TQSKISAQGDRVPPISDPFDNNNQIAYVDQSDSVDSSPVKEVRPTSHPGSLTKKPDGTAK
RSPSSKGASEPDRSLRKGRPVLASQESSLSSTSPSSPVPVKVSVKPSHSRSKADSSSRAS
GRHSSPAPGQPRKESSPKPQDSMSSPSPQRQKSSSSLTYTASSTSAKKASGPAARGPFPP
GKSRTSDRSLSREGSRQSLASDRASVTSSSKPNSPRVSQARAGEGRGDGKHVRSSSMASL
RSPNTNVKAGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTTLLSKKAGGSSVKLAGK
NAVDDKAEKGYQPPGSQQPNASAVGKEQLVSKDPASAKHSLLSARKSKSSQLDSGVPSSP
GGRQSAEKSSKKLSSSMQTSARPSQKPQ
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
nnnnnnnnnnnnnnnnnnnnnnnncggaaccacggcaacacgtgctttatgaacgccacg
ctgcagtgtctcagcaacaccgagctcttcgccgagtacctggcgctcggccagtaccgg
gcggggcggcccgagccctcgcctgaccccgaacagcctgtgggccgggggacgcagggc
cagggcgaggtcaccgagcagctggcgcacctggtgcgggccctctggaccctggagtac
acgccgcagcacagccgcgacttcaagagtattgtgtcaaagaacgcactgcagtatcgg
ggaaattcccagcatgacgcccaggagtttctgctgtggcttctggaccgagttcacgaa
gacctcaatcatgctgtgaagcagagcggccagcctcctctgaagccaccatcagagact
gatatgatgcccgagggaccatcttttcctgtctgtagcacttttgtacaagaacttttt
caagcccagtacagatcttctttgacatgtcctcactgtcagaagcagagcaacactttt
gaccccttcctctgcatttctttgccaattcctctaccccacacaaggcctctctatgtt
accgtagtgtatcaggggaaatgttctcactgcatgaggattggtgtggccgtgcctctg
tctgggactgtcgccaggcttcgcgaagcagtgtctatggaaacaaagatccccactgat
cagattgtgttaacggaaatgtactatgatgggttccatcgttccttttgtgacacagac
gacctggaaacagtccatgaaagcgactgcatttttgcctttgagactccagaaatattt
aggcctgaaggaattctcagtcaaagaggaatccacttaaacagcaatctaaaccacttg
aaatttgccttggatcatcgactgtcttctatgcaagcagcagcaaagcaagggaaaata
gacttgcccccaacaagagcagaaaatgacaagattgttctattagtgtgtaaccgagcg
tgcactgggcagcaagggaaaagatttggactgccttttgtgctgcacttagagaagaca
atagcgtgggaccttctgcagaaggaaatcttggagaagatgaagtatttcttgaggccc
acggtttgcatccaggtgtgtccattcagtttgcgtgttgtcagtgttgtggggataaca
tacttgctgccccaggaggagaagccgctatgccacccaacagtagaaagggcgttgaag
tcttgtggaccaggtggcactgctcatgtgaagttagtggtagaatgggacaaggaaaca
aaagatttcttgtttgtaaatactgaagatgaatatattcctgatgcagaaagcgtccgt
ctgcagagggagcgtcatcatcagcctcagacttgcactttatcccagtgtttccagctc
tacaccaaagaggagcggctcgccccagatgacgcctggcgttgcccgcactgtaagcag
ctgcagcaggggagcattacattaagcctctggactctgcctgatgtgcttattatacat
ctaaagagatttcgacaggaaggagacaggcgtgtgaaacttcagaacatggtcaagttc
cccttgactggcctggacatgacacctcatgtggttaagagaagtcagagcagctggagt
ttgccatcccattggtctccgtggagacggccctatggacttgggagggaccccgaggac
tacgtctatgacctgtatgctgtgtgcaatcatcatggcaccatgcaaggggggcactac
acagcatactgtaagaactctgtggatggcctctggtactgcttcgatgacagtgatgtg
cagcagctgtcagaagatgaggtctgcacacagacggcgtacatccttttctaccagagg
cggacagctattccgtcgtggtcggccaacagctcagtggcaggctctacgagttcttca
ctgtgtgaacactgggtgagccggctcccggggagcaagcaagccagcgtgacctccgca
gcttcctccagacgcacctccctggcctcattgtccgagtcggtggagatggccggggag
aggagtgaagacgatggaggtttctcaactcgaccattcgtgagaagtgtccagcgtcag
agcttgtcatccagatcttctgtcaccagccccttggccgttaacgacaattgcattaga
ccttcttggtccctgtccgccaagctgcagatgcgctccagttctccctcccggttctca
ggggactctccgatccacacctctgcctccaccttggagaagatcggggaggcagtagat
gacaaggtctccatctcttgctttggcagcttgaggaacctttccagcagttaccaggaa
ccaagtgatagtcacagccgacgtgagcacaaggctgtgggtcgggcccctctggctgtc
atggaaggcgtgttcagagatgaatcagacacccgcaaattgaactccagtgttatagac
acacagagcaaaatctcagcacaaggggatcgtgtgccccccatctctgatccatttgat
aacaataaccagatcgcttatgtggatcagagcgattctgtagacagctctccagtcaaa
gaggtgagacccacaagccacccaggctccctcacaaagaaaccagatggaacagccaag
agatctcccagctccaaaggcgcttctgagccagacagaagcttgcggaaggggagacca
gtcttggcaagccaggaatcatctctttcaagtacgtccccttcttctcctgttcctgta
aaagtttctgtaaagccctcccactcccgaagcaaagcagattcttcttccagggccagt
ggacggcattcctcccctgcccctggccagcccagaaaggagtcctcccccaaaccccag
gactccatgtcatctccttcaccccagaggcagaaatcatcttcctccctcacctacact
gcttcctccacatctgccaaaaaagcctcgggccctgctgcaaggggccccttccctcct
gggaagagcaggacttcagaccggagcttgagtagagagggctccaggcaaagcctggct
tcggacagagccagcgtcacctccagctctaaacccaactcccctcgggtgagccaggcc
agggccggggagggccgaggggatggaaagcacgtcaggagctcctccatggctagcctg
cgttcccccaacacaaacgtgaaggctggtctgaagagggacagcaagtcggaggacaag
gggctgtccttcttcaagtcagccttgagacagaaggaaacccggcggtcgactgacctc
ggcaaaaccaccttgctctccaagaaggctggtgggagctctgtcaagttggctggtaag
aatgccgtggatgacaaggcagagaaaggctaccagcctccaggttcccagcagccaaat
gcaagtgcagttggaaaagagcagcttgtctccaaggaccctgcttctgctaaacattcc
ctgctatccgctcgcaaatccaagtcttcccagctagattctggagtgccctcgtctcct
ggtggcaggcagtctgctgagaaatcctcaaaaaagttatcttctagcatgcaaacctct
gcacggccttctcaaaaacctcagtga

DBGET integrated database retrieval system