KEGG   Ailuropoda melanoleuca (giant panda): 100476627Help
Entry
100476627         CDS       T01329                                 

Definition
group XVI phospholipase A2-like
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aml00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:aml00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aml00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:aml00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:aml00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 162 aa AA seqDB search
MRASIPEPKVGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASIMSTLTEKAVV
KKELLYDVVGRDKYQVNNKHDGKYSPLPPSKIVQRAEELVGQELPYSLPCENCEHFVNEL
RYGVARSDQVRDAVVAAGIAGVGLAAMGLIGVMFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgtccatcccagagcccaaagttggagacctgattgagattttccgccctttc
tacagacactgggccatctacgttggtgatggatacgtggtccacctggcccccccaagt
gaagttgcgggagctggtgcggccagcatcatgtccaccctgaccgagaaggctgtagtg
aagaaggaactgctgtacgatgtggtcgggagagacaagtaccaggtcaacaacaaacat
gatggcaagtactcaccgctgcctcccagcaaaatcgtccagcgcgcagaggagctcgtg
gggcaggagttgccctattcgctgccctgcgagaactgcgagcactttgtgaacgagctg
cgctatggagttgcccgcagtgaccaggtcagagatgccgtcgtggcggctggcatcgca
ggagtgggcttggcagccatgggcctcattggagtcatgttctcaagaaacaagcggcag
aagcaataa

DBGET integrated database retrieval system