KEGG   Ailuropoda melanoleuca (giant panda): 100476761Help
Entry
100476761         CDS       T01329                                 

Definition
GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100476761
Cellular antigens [BR:aml04090]
 Proteins
  100476761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 311 aa AA seqDB search
MQTPAMMSLLLVCLGLMEAHQAQSHPLTRRELFSQEVPLDMAPASFDDQYDGCAAAXXXX
XXXXADRASQWQERQAWGPEWGPRPTELPPPPPGFRDEHGVALLAYTANNPLHKQFNAAV
REAGRSRAYYLHHFSFKTLHFLLTEALQLLGRGQRSPQCRQVFRGVHGLRFRPAGPGATV
RLGGFASASLQNVAAQQFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVINAS
RPAQGPARIYLRALGKRSTYNCEYIKDKQCKSRPCRLGNSAMGQGSASAVWSLLLPLWVL
VGGTFPRPIQH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcagactcctgccatgatgtctctgctgcttgtgtgcctgggcctcatggaagctcat
caggcccagagccaccccctcactcgacgagagctcttctctcaagaagtgcccctggac
atggccccagcctcctttgatgaccagtatgacggctgtgcagcagccatnnnnnnnnnn
nnnnnnnnnngggcggacagagccagccaatggcaggaacgccaggcctgggggccagag
tggggccccaggcctaccgagctgcccccgccgccccctggcttccgcgatgagcatggg
gtggccctcctggcctataccgccaacaaccccctgcacaagcagttcaacgctgccgtg
cgcgaggcaggccgctccagagcctactacctccaccacttctccttcaagacactccat
ttcctgctgaccgaggccctacagctgctgggcaggggccagcgttcgccccagtgccgc
caggtgttccgaggggtgcacggcctgcgcttccggccggcggggcccggggccaccgta
aggctgggggggtttgcctccgcatccctgcagaatgttgcagcccagcagtttggggag
gacaccttctttggcatctggacttgcctcggggcacctatcaagggctactccttcttc
cctggggaggaggaggtgctgatcccccccttcgagacgttccaggtgatcaatgccagc
agaccggcgcagggccccgcccgcatctacctccgggccctgggcaagcgcagcacgtac
aactgcgagtacattaaagacaagcagtgcaagtctaggccctgccgtctaggtaactca
gccatgggtcaaggctctgcttctgcagtctggtccctcctactgccgctctgggtcctt
gtcgggggaacctttccacgacccatccaacactga

DBGET integrated database retrieval system