KEGG   Ailuropoda melanoleuca (giant panda): 100476783Help
Entry
100476783         CDS       T01329                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100476783
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100476783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 231 aa AA seqDB search
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtaacaccatgtctgtgcccctgctcaccgatgctgccaccgtgtctggagct
gagcgggaaacggctgcggttatttttttacatggacttggagacacagggcacagctgg
gctgacgccctctccaccatccggctccctcacgtcaagtacatctgtccccatgcaccc
cggatccctgtgacactcaacatgaagatggtgatgccctcctggtttgacctgatgggg
ctgagtccagatgccccagaggacgaggctggcatcaagaaggccgcagagaacatcaag
gccttgattgagcacgagatgaagaatgggatccctgccaatcgaatcgtcctgggaggc
ttttcacagggtggggccctgtcactctacacagcccttacctgtccccaccctctggct
ggcattgtggcattgagctgttggctgcctctgcatcgggccttcccccaggcagccaat
ggcagtgccaaggacctggccatccttcagtgccatggggagctggaccccatggttcca
gtacggtttggggccctgacggctgagaagctccggtccgttgtcacacccgccagggtc
cagttcaagacttatccaggtgtcatgcacagctcctgtcctcaggagatggcagctgtg
aaggagtttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system