KEGG   Ailuropoda melanoleuca (giant panda): 100476798Help
Entry
100476798         CDS       T01329                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aml00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 923 aa AA seqDB search
MLWRGSQALRLFSTGQVYFKNKLKLALIGQSLFGQEVYHHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYKSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDIEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLKSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGRMIPASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYVSKEVNEMTVKMPYQCFINGEFTDADDGKTYDTINPTDGSTICKVSYASLV
DVDKAVAAAKDAFEKGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNHNLTFTRKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHQAHLEKLL
QYCEAGVKEGATLVYGGRQVHRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDISKAMYVSEKLEAGTVFVNTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggaggggcagccaggcgctccggctcttctccaccggccaggtttatttcaaa
aacaagctgaagttggcactcattggtcagagcctctttgggcaggaagtctaccaccac
ctctgcaaagagggccaccgagttgtaggcgtgttcacagttccagacaaggatggaaaa
gctgacccgctggctctagctgcagagaaagatgggacccctgtgttcaagttccccaga
tggagagtcaagggcaagaccataaaggaggtggcagaggcctacaaatctgtgggtgct
gagctaaacgtgcttcccttctgcacacagtttatccctatggatatcattgacagccca
aagcacggttccatcatatatcacccctccatccttcccaggcacagaggagcctctgct
atcaactggactctaattatgggcgataagaaagctggtttttctgttttctgggctgat
gatggtttagacacaggacccatccttcttcagaggtcatgtgacattgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtggaa
gctgtccaactcatagctgatggaaaagctcctcggattccccagccggaagaaggggca
acatatgaaggtatccagaaaaaggaaaatgctgagatttcttgggatcagtcggccgaa
gttttacataactggatccgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcacgttctacggctcatcattgctgaaaagctccgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtcttgttaccaaaaatggacttgttctt
tttggtaatgatggaaaagcactgatggtgagaaatctgcagtttgaagatggaagaatg
attcctgcttctcagtacttttcagccggcgagacatcggtggtagaacttacagccgaa
gaggtgaaggtggcagagaccatcaaggtcatctgggctggaattttaagcaatgtccct
gtcattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgtcagg
ctggttgaagagatcagacagaagtgtggtgggcttcagctacagaacgaagatgtctac
atggccaccaagtttgaagacttcatccaaaaagttgtgaggaaactgagaggagaagat
caagaagtggagctggtcgtggattatgtttcgaaagaggtcaatgaaatgacagtgaaa
atgccatatcagtgtttcataaatggagagttcacagatgctgatgatggaaagacctac
gatactatcaacccaacagacggatctaccatatgcaaagtatcctatgcttctttggtg
gacgttgataaagcagtagcagccgcaaaagatgcctttgaaaaaggtgaatggggaagg
atgaatgcaagagaaagaggaagattgatgtacagacttgcagacctcctggaagagaac
caagaagagttggcaaccattgaagcccttgactcgggcgctgtctacaccctggctctg
aagactcacatcggaatgtctgtgcaaacattcagatactttgctggctggtgtgacaaa
atccagggttctaccattccaatcaaccaggcccgtccaaatcacaatctgaccttcacc
aggaaggagccacttggcgtctgcgccattatcatcccctggaattacccgctgatgatg
ctggcgtggaagagcgctgcgtgtttggcagcaggcaataccttagtgctcaagccagcg
caggtcacacccttgactgctttgaagtttgctgagctctctgtgaaagcaggctttcca
aagggggtaatcaacatcattccaggctcaggtggcatagcagggcaacgcctttctgaa
catcctgatatccgcaaacttggtttcactgggtccactgctattggcaaacagatcatg
aagagctgtgctgtgagcaacttgaagaaagtttcccttgaacttggtggcaaatcccca
cttataatattcaatgactgtgaacttgacaaggccgtgcgaatgggcatgggggcagtc
tttttcaacaaaggagagaattgcattgcagctggacggttgtttgtggaagaatccatc
cacgacgaatttgtgacaagagtggtggaagaaattaaaaagatgaaaattggtgatcca
cttgacagatctactgatcacgggccccaaaatcatcaggcccatctggaaaagcttctg
caatactgtgaagctggggtgaaagaaggggccaccttggtgtacgggggaagacaagtc
cacaggccaggcttttttatggaaccaactgttttcacagatgtggaagaccacatgtat
cttgccaaagaggagtcatttgggcctattatggtcatttctaaattccaaaatggggac
atcgatggagtgttgcagcgagcaaataatacagagtatggtctggcctcaggggttttt
acgagagacatcagtaaagccatgtatgtgagcgaaaaactagaagcaggaactgttttt
gtgaacacgtacaacaagacggatgtggcagcccctttcgggggagtgaaacaatctggc
tttgggaaagacttaggggaggaagctctaaacgaatacctcaaaaccaagacggtgacg
ctggagtactag

DBGET integrated database retrieval system