KEGG   Ailuropoda melanoleuca (giant panda): 100476824Help
Entry
100476824         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 33-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100476824
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100476824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 932 aa AA seqDB search
MVLEFTTPRSKVLPHLEILGRQEKISNRMAAFRNHCPHLDSVGEITKDDLIQKSHGTCQD
CKVRGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFL
DRKLGTQPSLPHVRPLQQTQENSVQDFKIPSNTTLKTPLVAVFDDLDIEVEEEDELKARG
LTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKS
RPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQTITT
EETMEEDKSQSDVDFQSCESCSSSDKAENENGSRGFSEDNNETTMLIQDDENNSEMSKDW
QKEKMCNKINKVNSEGELDKDRDSVSETVDLNNQETVKVQIHSRASEYITDVHLNDLSTS
QILPSNEGVNPRLSASPPKSGNLWPGLAPTHKKAQSASSPKRKKQHKKYRSVISDIFDGT
IISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGW
IAFFMEYVKSWFWGPIVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPE
ILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPVQIVTYDLLSVICHHGTAS
SGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLL
NIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNI
WDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQEEDSPATFYCI
SMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGSVMLRQGADSGQISEETWNFLQSIYG
GGPEVILRPPVVHVDPDVLQAEEKIEVETRSL
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttgaattcacaacccccagatcaaaagtattacctcatttggaaatacttggg
agacaggaaaaaatttctaacagaatggcagcttttcgaaatcattgtccacatttggat
tcagttggtgaaataacgaaagacgacctaatacaaaaatctcatggtacttgtcaggat
tgtaaagtcagaggaccaaatctttgggcatgcctggagaataggtgttcatatgttggt
tgtggtgaatcacaagtagatcacagcaccatacactctcaggagacaaagcattatcta
actgtgaaccttaccactcttcgagtatggtgttatgcttgtagcaaagaagtattcttg
gataggaaattaggaactcagccttctttgcctcatgtaagaccacttcagcaaacacaa
gaaaacagtgtccaggattttaaaatacccagtaatacaacattaaaaactcctctggtt
gctgtgtttgatgatttggacatagaagtggaagaagaagatgaacttaaggcaagaggt
cttacgggtttgaaaaatattggaaatacttgttatatgaatgcagctttgcaggctctt
tctaattgcccacctttgacacagttttttcttgattgtggaggactagctcgaacagat
aagaaaccagccatttgcaaaagttatctcaaactgatgacagaactgtggcataaaagc
aggccaggatctgttgtgcctactactctgtttcaaggaattaaaacagtaaatccaaca
tttcggggctattctcagcaggatgctcaagaattccttcgatgtttgatggatctgctt
catgaagaattaaaagaacaggtcatggaagttgaggaagatcctcaaactataacgact
gaagagaccatggaagaagacaagagccaatcagatgtagattttcaatcctgtgaatct
tgcagcagcagtgataaagcagaaaatgaaaatggttctagaggcttttcagaagataat
aacgaaacaacaatgttgattcaggatgatgagaacaattccgaaatgtcaaaagattgg
caaaaagagaagatgtgcaataagattaataaagtaaattctgaaggagaattagataaa
gatagagactctgtgtctgaaacagtcgacttgaacaaccaggaaactgttaaagtgcaa
atacacagcagagcttcagaatatattactgatgtccatttgaatgacctgtctacatca
cagatcctcccatcaaatgaaggtgttaatccacgtttatcagcaagccctcctaaatca
ggcaatttgtggccaggattggcacccacacacaaaaaagctcaatctgcatcatctcca
aagagaaaaaaacagcataagaaataccgaagtgttatttcagacatatttgatggaaca
attattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgagaccttt
caagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattcatccagt
cacccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaagggtgg
atagcttttttcatggaatatgtgaagagctggttttggggtccaatagtaaccttgcaa
gattgtcttgctgccttcttcgccagagatgaactaaaaggtgacaatatgtacagttgt
gaaaaatgcaaaaagttaaggaatggagtaaagttttgtaaagtacaaaaatttcctgag
attttatgcatccatcttaaaagattcagacatgaactgatgttttcaaccaaaatcagt
acccatgtttcatttccgctggaaggtctggatcttcagccatttcttgctaaagatagt
ccagttcagattgttacctatgatcttctgtcagtcatttgtcatcatggaactgcaagt
agtggacactatattgcctactgccgaaacaatttaaataatctctggtatgaatttgat
gatcaaagtgtcactgaagtttcagaatctactgtacaaaatgcagaagcttatgttctt
ttctataggaaaagcagtgaagaggcacaaaaagagagacgaaggatatcaaatttattg
aacataatggagccaagtctccttcagttttatatttctcgacagtggctaaataaattt
aagacctttgctgaacctggccccatttcaaataacgattttctctgtattcatggaggt
gttcctccacgaaaagctggttatattgaagacctggttttgatgctgcctcagaacatt
tgggataatctatatagcaggtatggaggaggaccagctgtcaaccatctgtacatttgt
cacacttgccaaattgaggcagagaaaattgaaaaaagaagaaaaactgaattggaaatt
tttattcggctcaacagagcattccaagaggaggactctccagccactttttattgcatc
agtatgcagtggtttagagaatgggaaagttttgtgaagggtaaagatggagatcctcca
ggtcctattgataacactaaaattgcagtcactaaatgtggcagtgtgatgctcaggcaa
ggagcagattctggtcagatttctgaagaaacgtggaattttctacaatctatatatggt
ggagggcctgaagttatcctacgacctccagttgttcatgttgaccctgatgtactacaa
gcagaagaaaaaattgaagtagaaactcggtctttgtaa

DBGET integrated database retrieval system