KEGG   Ailuropoda melanoleuca (giant panda): 100476972Help
Entry
100476972         CDS       T01329                                 

Gene name
STAMBP
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aml04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 424 aa AA seqDB search
MSDHGDVSLPPEDRVRALSQMGSAVEINEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKEELLKRYTKEYTE
YNEEKKREAEELARSVAMRQELEKERQRVAQQKQQQLEQEQFHAFEVMIRNQELEKERLK
IVQEFGKVDPGLGGPLVPDLEKPSPAAFPPAPVASAQSTDCNTAVKPARPPVVDRSLKPG
ALTNSESTPTIDGLRHVVVPERLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL
IPKQSAGSDYCHTENEEELFLIQDQQSLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCNHVTVVDRAVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggagatgtgagccttccacccgaagaccgggtgagggccctctcccag
atgggtagcgcagtggagataaatgaagacattccacctcgacggtacttccgctctgga
gtcgagattatccgaatggcatccatttactctgaggaaggcaacattgaacatgccttc
atcctctataacaagtatatcacgctttttattgagaaactcccaaagcatcgagattac
aaatcggctgtcattcctgaaaagaaagacacagtaaagaagttaaaggagattgcattt
cccaaagcagaagagctgaaggaagagctattaaaacgatataccaaagaatatacagaa
tataatgaagaaaagaagagggaagcggaagagctcgcccggagcgtggccatgcggcag
gagctggagaaggagcggcagcgggtggcgcagcagaagcagcagcagttggagcaggag
cagttccatgcctttgaggtgatgatccggaaccaggagctggaaaaggagcggctcaaa
atcgtgcaggagtttgggaaggtggaccctggcctaggtggccccctggtgccggacttg
gagaagccctccccagccgcgttccccccggcacctgtggcatccgcgcagtctacggac
tgtaatacggccgtgaagcctgccaggccacccgtggtggacaggtccttgaaacctgga
gcgctgaccaactcagaaagtactcctacaatcgacggactgcgccatgtggtggtgcct
gagaggctctgcccgcagtttctccagctagccagtgccaacacagcccgaggagtagag
acatgtggaattctctgtggaaaactgatgaggaatgagtttaccattacccatgttctc
atccccaagcaaagtgccgggtctgattattgccacaccgagaacgaagaagagctcttc
ctcatacaggatcagcagagtctcatcacactgggctggatccacactcatcccacacag
actgccttcctctccagtgttgacctacacactcattgctcctaccagatgatgttgccg
gagtcaatagccattgtttgctcccccaagttccaggaaactggattctttaaactaact
gaccatgggctagaggagatttcttcctgtcgccagaaaggatttcatccacacagcaag
gatccgcctctcttctgtagctgcaatcatgtgaccgttgtggacagagcagtgaccatc
acagaccttcgatga

DBGET integrated database retrieval system