KEGG   Ailuropoda melanoleuca (giant panda): 100477081Help
Entry
100477081         CDS       T01329                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Vascular smooth muscle contraction
Regulation of actin cytoskeleton
Proteoglycans in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:aml04810]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:aml04270]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:aml05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 911 aa AA seqDB search
MEAEDVARGLAPGPPRPGLVPVSIIGAEDEDFENELETNAEEQNSQFQSLEQVKRRPAHL
MALLQHVALQFEPGPLLCCLHADMLASLGPKEAKKAFLDFYHSFLDKTAVLRVQVPPTVA
FELDRTRPDLLSEDVQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEHDLTQLEAWV
GRDRASFEARERHLAERLLSHPDLEEMQHTISTDEEKSAAVVNAISLYMRHLGVRTKSGD
KKSGRNFFRKKMMGNRRSDEPTKSKKGLSIFLDAARWNRGEPQAPDFRHLKVEADAEKPG
LTEKRGGLGVPSRDRNFGAPGQDVPGVSLHPLSGDSPDREPGLDATPELGDPPPQGPASL
EPLVPPESTEEGADTESPEPGDEGDPGRSGLELEPEEPPGWRELVPVGTLHSLPKSQVKR
QEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFSQEELQNIFPSLDELIEVHSLFLDR
LMKRRQDSGYLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKVKQRKEPRFC
AFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPVERERVELAAECCRE
ILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWR
VTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTRE
VATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCSLITDTAGSLKVPAPASRPKSRPSP
SSTREPLLSSSENGNGGGREIPPGDGRMERILSALLPYCRPVPEGQLAAKALEKVLSLKQ
LLFPSEEDSGAGPPREGDGVPGGGSQSPTQTQEIREKLLSLEEQEVEEEFCRLRLLLSQL
GENSVQQPGCT
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaggacgtcgcccgcgggctggccccaggaccaccgcggcctggcctggtg
ccagtcagcatcatcggggctgaggatgaggattttgagaatgagctggagacgaacgca
gaggagcaaaacagccagttccagagcctggagcaggtgaagcggcggcctgcccacctc
atggcgctcctgcagcacgttgccctgcagtttgaaccgggacccctgctctgctgcctt
cacgcggatatgctggcttccctgggccccaaggaggccaagaaggccttcctcgacttc
taccatagctttctggacaagaccgcggttttgcgggtacaagtccctcccactgtcgcc
tttgaacttgaccgcacgcggcccgacctcctctctgaggacgtccagcggcagttcgtg
caggaggtggtgcagagccagcaggccgccgtcagccggctgctggaggacttccgctcc
aagcggctcatgggcatgacgccctgggagcatgacctgacccagctggaggcctgggtt
gggcgggaccgggccagctttgaggcgcgggagcggcacttggccgagcggctgctgagc
cacccagacctagaggagatgcaacacaccatctctaccgatgaggaaaagagtgccgct
gtggtcaacgcgatcagcctgtacatgcgccaccttggggtgcggaccaagagcggggac
aagaagtcggggaggaatttcttccgaaaaaagatgatgggcaatcgacggtcagatgag
ccaaccaagagcaagaaaggcctgagcatcttcctggacgctgcccgctggaaccgggga
gagcctcaggccccagatttccgacacctcaaagtcgaggctgatgctgagaagccaggc
cttacggaaaagaggggaggcctgggggtgccctcccgggaccggaactttggggctcct
gggcaggatgtccctggagtttctctgcaccctctatctggagatagccctgaccgggaa
ccaggtcttgatgccacaccagagctgggggacccgcccccacagggcccggccagcctg
gagcccctggtacccccggagagcaccgaggagggtgctgacacagagagccctgagcct
ggagacgaaggggacccgggacggtcaggactagagctggaaccagaagagccccctggc
tggcgggagctcgtcccagttggcaccctgcacagcctgcctaagagccaggtgaagcgg
caggaggtcatcagcgagctgctggtgacagaggccgcccacgtgcgcatgctccgggtg
ctgcatgacctcttctaccagcccatggcagaagggggcttcttctcccaggaggagcta
cagaacatctttcccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgg
ctgatgaagcggaggcaggatagtggctacctcattgaggagatcggagacgtactgctg
gcccggtttgatggtgccgaaggcaaatggttccagaaaatctcctcccgcttctgcagc
cgccagtcgtttgccttagagcagctcaaagtcaagcagcgcaaggagcctcggttctgt
gccttcgtgcaggaggcggagagccgcccgcggtgccgccgcctgcagctgaaggatatg
atccccacggagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcag
aacacagaagagccggtggaacgggagagagtggaactggcagccgagtgctgccgggag
attctgcaccatgtgaaccaagccgtgcgtgacatggaggacctgctgcggctcaaggat
tatcagaagcgcctggacttgtcccacctgcggcagagcagcgaccccatgctgagcgag
ttcaagaacctggacatcaccaagaagaagctggtgcacgagggcccgctgacgtggcgg
gtgacgaaggacaaggctgtagaggtccacgtgctgctgctggacgacctgctgctgctg
ctccagcgccaagacgagcggctgctgctcaagtcccacagccggacgctgacgcccacg
cccgatggcaagaccatgctgcggcccgtgctgcggctcacgtccgccatgacccgcgag
gtggctaccgatcacaaagccttctatgtcatttttacgtgggaccaagaagcccagata
tatgaactggtggcccagaccgtgtcggaacgaaaaaactggtgttccctcatcaccgac
actgctggatccttgaaggtccctgctcccgcctctcgccccaaatcccggcccagccct
agcagcacacgagaacccctgctcagcagctcggagaatggcaacgggggtggccgagag
atacccccaggggacggccgaatggagagaatcctcagcgccctcctgccctactgcagg
cccgtccccgagggccagcttgctgccaaggcccttgagaaagtgctatccctgaagcag
ctcctgtttccctcggaggaagacagtggggcagggcctccccgtgaaggggatggggtc
ccagggggtggctcccagagcccgacccagacccaggagattcgggagaagctgctcagc
ctggaggagcaggaggtggaggaggaattttgtcgcctgcggctcctcctgtctcagctt
ggggagaacagcgtccagcagcctggctgtacctga

DBGET integrated database retrieval system