KEGG   Ailuropoda melanoleuca (giant panda): 100477081Help
Entry
100477081         CDS       T01329                                 

Gene name
ARHGEF1
Definition
Rho guanine nucleotide exchange factor (GEF) 1
Orthology
K12330  
Rho guanine nucleotide exchange factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100477081 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100477081 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100477081 (ARHGEF1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100477081 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 911 aa AA seqDB search
MEAEDVARGLAPGPPRPGLVPVSIIGAEDEDFENELETNAEEQNSQFQSLEQVKRRPAHL
MALLQHVALQFEPGPLLCCLHADMLASLGPKEAKKAFLDFYHSFLDKTAVLRVQVPPTVA
FELDRTRPDLLSEDVQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEHDLTQLEAWV
GRDRASFEARERHLAERLLSHPDLEEMQHTISTDEEKSAAVVNAISLYMRHLGVRTKSGD
KKSGRNFFRKKMMGNRRSDEPTKSKKGLSIFLDAARWNRGEPQAPDFRHLKVEADAEKPG
LTEKRGGLGVPSRDRNFGAPGQDVPGVSLHPLSGDSPDREPGLDATPELGDPPPQGPASL
EPLVPPESTEEGADTESPEPGDEGDPGRSGLELEPEEPPGWRELVPVGTLHSLPKSQVKR
QEVISELLVTEAAHVRMLRVLHDLFYQPMAEGGFFSQEELQNIFPSLDELIEVHSLFLDR
LMKRRQDSGYLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKVKQRKEPRFC
AFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPVERERVELAAECCRE
ILHHVNQAVRDMEDLLRLKDYQKRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWR
VTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTRE
VATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCSLITDTAGSLKVPAPASRPKSRPSP
SSTREPLLSSSENGNGGGREIPPGDGRMERILSALLPYCRPVPEGQLAAKALEKVLSLKQ
LLFPSEEDSGAGPPREGDGVPGGGSQSPTQTQEIREKLLSLEEQEVEEEFCRLRLLLSQL
GENSVQQPGCT
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaggacgtcgcccgcgggctggccccaggaccaccgcggcctggcctggtg
ccagtcagcatcatcggggctgaggatgaggattttgagaatgagctggagacgaacgca
gaggagcaaaacagccagttccagagcctggagcaggtgaagcggcggcctgcccacctc
atggcgctcctgcagcacgttgccctgcagtttgaaccgggacccctgctctgctgcctt
cacgcggatatgctggcttccctgggccccaaggaggccaagaaggccttcctcgacttc
taccatagctttctggacaagaccgcggttttgcgggtacaagtccctcccactgtcgcc
tttgaacttgaccgcacgcggcccgacctcctctctgaggacgtccagcggcagttcgtg
caggaggtggtgcagagccagcaggccgccgtcagccggctgctggaggacttccgctcc
aagcggctcatgggcatgacgccctgggagcatgacctgacccagctggaggcctgggtt
gggcgggaccgggccagctttgaggcgcgggagcggcacttggccgagcggctgctgagc
cacccagacctagaggagatgcaacacaccatctctaccgatgaggaaaagagtgccgct
gtggtcaacgcgatcagcctgtacatgcgccaccttggggtgcggaccaagagcggggac
aagaagtcggggaggaatttcttccgaaaaaagatgatgggcaatcgacggtcagatgag
ccaaccaagagcaagaaaggcctgagcatcttcctggacgctgcccgctggaaccgggga
gagcctcaggccccagatttccgacacctcaaagtcgaggctgatgctgagaagccaggc
cttacggaaaagaggggaggcctgggggtgccctcccgggaccggaactttggggctcct
gggcaggatgtccctggagtttctctgcaccctctatctggagatagccctgaccgggaa
ccaggtcttgatgccacaccagagctgggggacccgcccccacagggcccggccagcctg
gagcccctggtacccccggagagcaccgaggagggtgctgacacagagagccctgagcct
ggagacgaaggggacccgggacggtcaggactagagctggaaccagaagagccccctggc
tggcgggagctcgtcccagttggcaccctgcacagcctgcctaagagccaggtgaagcgg
caggaggtcatcagcgagctgctggtgacagaggccgcccacgtgcgcatgctccgggtg
ctgcatgacctcttctaccagcccatggcagaagggggcttcttctcccaggaggagcta
cagaacatctttcccagcctggacgagctcatcgaggtgcattccctgttcctcgatcgg
ctgatgaagcggaggcaggatagtggctacctcattgaggagatcggagacgtactgctg
gcccggtttgatggtgccgaaggcaaatggttccagaaaatctcctcccgcttctgcagc
cgccagtcgtttgccttagagcagctcaaagtcaagcagcgcaaggagcctcggttctgt
gccttcgtgcaggaggcggagagccgcccgcggtgccgccgcctgcagctgaaggatatg
atccccacggagatgcagcggctgaccaagtaccccctgctcctgcagagcatcgggcag
aacacagaagagccggtggaacgggagagagtggaactggcagccgagtgctgccgggag
attctgcaccatgtgaaccaagccgtgcgtgacatggaggacctgctgcggctcaaggat
tatcagaagcgcctggacttgtcccacctgcggcagagcagcgaccccatgctgagcgag
ttcaagaacctggacatcaccaagaagaagctggtgcacgagggcccgctgacgtggcgg
gtgacgaaggacaaggctgtagaggtccacgtgctgctgctggacgacctgctgctgctg
ctccagcgccaagacgagcggctgctgctcaagtcccacagccggacgctgacgcccacg
cccgatggcaagaccatgctgcggcccgtgctgcggctcacgtccgccatgacccgcgag
gtggctaccgatcacaaagccttctatgtcatttttacgtgggaccaagaagcccagata
tatgaactggtggcccagaccgtgtcggaacgaaaaaactggtgttccctcatcaccgac
actgctggatccttgaaggtccctgctcccgcctctcgccccaaatcccggcccagccct
agcagcacacgagaacccctgctcagcagctcggagaatggcaacgggggtggccgagag
atacccccaggggacggccgaatggagagaatcctcagcgccctcctgccctactgcagg
cccgtccccgagggccagcttgctgccaaggcccttgagaaagtgctatccctgaagcag
ctcctgtttccctcggaggaagacagtggggcagggcctccccgtgaaggggatggggtc
ccagggggtggctcccagagcccgacccagacccaggagattcgggagaagctgctcagc
ctggaggagcaggaggtggaggaggaattttgtcgcctgcggctcctcctgtctcagctt
ggggagaacagcgtccagcagcctggctgtacctga

DBGET integrated database retrieval system