KEGG   Ailuropoda melanoleuca (giant panda): 100477176Help
Entry
100477176         CDS       T01329                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100477176
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100477176
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100477176
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100477176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 567 aa AA seqDB search
MEFSSPPREACPRLLGRVGTMAASLTGLLLLQAVSWASGARPCSPRSFGYSSVVCMCNAT
YCDSLDPLTPPAPGTFSRYESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPPARNLLLKSYFSEEGIEYNIIRVPMASCDFSVRTYTYDDSPGD
FQLRNFSLPEEDVALKIPLIHQALELARRPVSLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDLYHQTWARYFVKFLDAYAEHRLRFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIA
RDLGPALANSTHHDIRLLILDDQRLLLPHWARVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDW
NLALNLEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLQASKR
NGLDTVALMRPDGSAVVVVLNRSPKDVPLTIEDPAVGFVETLSPGYSIHTYVWHRQGLGS
ARALKGQSRLTCCLWLRRVSEGWGEPR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcaagtcctcccagagaggcatgtccccggctcctgggcagggtaggcacc
atggctgccagcctcacgggattgcttctacttcaggcagtatcgtgggcatcaggtgcc
cggccctgcagccctagaagctttggctacagctcagtggtctgcatgtgcaatgccacg
tactgcgactcccttgaccccctgaccccgcctgcccctggcaccttcagccggtatgag
agcacgcgcagcgggcgccgaatggagctgagtctggggaccatccaggccaaccgcacg
ggcacagggctgctactgaccctgcagccagaccagaagttccagaaagtgaaggggttt
ggaggggccatgacagatgctgctgccctcaacatcctcgccctgtcaccccctgcccgg
aatttgctactcaaatcctatttctctgaagaaggaatcgagtacaacatcatccgagtc
cccatggccagctgtgacttctccgtccgcacctacacctatgatgacagccctggcgac
ttccagttgcgcaacttcagcctccctgaggaggacgtcgcgctcaagatacccctgatt
caccaagccctggagctggctcgacgccccgtgtcactgtttgccagcccctggacgtca
cccacgtggctgaagaccaacggggccgtgaatgggaaggggtcactcaagggtcagcct
ggggatctctaccaccagacctgggccagatactttgttaagttcctggatgcatatgcg
gagcacaggttacggttctgggcagtgacggcagagaacgagccctctgcggggctgctc
agtgggtaccccttccaatgcctgggcttcactcctgaacaccagcgagacttcattgcc
cgggacctgggtcctgccctcgccaacagtacgcaccacgacatccgtctgctcattttg
gatgaccaacgcttgctgctgccccactgggcccgggtggtgctggcagacccggaggcg
gccaagtacgtccacggcattgctgtacactggtacctggactttctggccccagcaaaa
gccaccctgggggagacacaccgcctgttccccaacaccatgctctttgcctcagaggcc
tgtgtgggctccaagttttgggagcagagtgtgcgcctgggctcctgggaccgaggggtg
caatacagccacagcatcatcacgaaccttctctaccacgtggccggctggacggactgg
aacctggccctgaacctagaagggggccccaactgggtgcgtaactttgtggacagccct
atcattgtcgacatcgccaaagacacgttttacaaacagcccatgttctatcacctcggc
cacttcagcaagttcattccggagggctcccagagagtggggctgcaggccagcaagagg
aacggcttggacacagtggctctgatgcgtcctgatggctccgcggtcgtggtggtgctg
aaccgctcccctaaggacgtgcctctcaccatcgaggaccctgccgtgggcttcgtggag
acgctgtccccgggttactccatccacacctacgtatggcaccgccagggcctgggctcg
gcacgggcattaaaggggcagagccggctcacatgctgtctgtggctgaggagggtctcg
gagggctggggtgagcctaggtga

DBGET integrated database retrieval system