KEGG   Ailuropoda melanoleuca (giant panda): 100477208Help
Entry
100477208         CDS       T01329                                 

Gene name
USP27X
Definition
(RefSeq) ubiquitin specific peptidase 27, X-linked
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100477208 (USP27X)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100477208 (USP27X)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100477208 (USP27X)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100477208 (USP27X)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     100477208 (USP27X)
    SLIK complex
     100477208 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MCKDYVYDKDIEQIAKEEQGEALKLQASASTEVSHQQCSVPGLGEKYPTWETTKPELELL
GHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDAGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGND
ENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEHESEKVKEMNTQAY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggactatgtatatgacaaagacattgagcaaattgccaaagaagagcaagga
gaagctttgaaattacaagcctccgcctcaaccgaggtttctcaccagcagtgttcagtg
ccgggactcggtgagaaatacccaacctgggagacgaccaaacccgagttagaactgctg
gggcacaacccacggagaagaagaatcacttcgagcttcaccatcggcttaagaggactg
atcaatcttggcaacacgtgctttatgaactgcatcgtccaggcccttacccatactccg
atcctgagagatttcttcctctccgacaggcacagatgtgaaatgccaagccctgagttg
tgtctggtctgtgagatgtcttcactttttcgggagttgtattctggaaacccatctcct
cacgttccttataagttactgcacctggtatggatacatgcccggcacttagccggatac
aggcaacaggatgcccacgagttcctcatcgcagcactagatgtcctgcacaggcactgc
aaaggtgatgatgctgggaaggccgccaacaatcccaaccactgtaactgcatcatagac
caaatcttcacaggtggcctgcagtctgatgtcacctgtcaagcctgccatggcgtctcc
accaccatagacccatgctgggacatcagtttggacttgcctggctcttgcacttccttc
tggcccatgagcccagggagggagagcagtgtgaatggggaaagccacataccaggaatc
accaccctcacggactgcttgcgaaggtttacgaggccagagcacttgggaagcagtgcc
aaaatcaaatgcggtagttgccaaagctaccaggaatctaccaaacagctcacaatgaat
aaattacctgttgttgcctgttttcatttcaaacggttcgaacactcggccaaacagagg
cgcaagatcactacatacatatcctttcctctggagctggatatgacaccatttatggcc
tcgagtaaagagagcaggatgaatggacagttgcagctgccaaccaatagtggaaacgat
gagaataagtattccttgtttgctgtggttaatcaccaaggaaccttggagagtggccac
tacaccagcttcatccggcaccacaaggaccagtggttcaagtgtgatgatgccgtcatc
accaaggccagtattaaggacgttctggacagtgaagggtatttactgttctatcacaaa
caggtcctggaacatgagtcagaaaaagtgaaagaaatgaatacacaagcctactga

DBGET integrated database retrieval system