KEGG   Ailuropoda melanoleuca (giant panda): 100477335Help
Entry
100477335         CDS       T01329                                 

Gene name
PLA2G15
Definition
(RefSeq) phospholipase A2 group XV
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00564  Glycerophospholipid metabolism
aml04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100477335 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100477335 (PLA2G15)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100477335 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT Abhydrolase_6 Abhydrolase_1 Hydrolase_4 FGase DUF915
Motif
Other DBs
NCBI-GeneID: 100477335
NCBI-ProteinID: XP_002923259
Ensembl: ENSAMEG00000008018
UniProt: G1LN15
Position
Un
AA seq 408 aa AA seqDB search
MGLRLCPYHAALLPGGVLFLLLLADPALPVGRPPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLIYNRTSRATQFPDGVDVRVPGFGKTFSL
EFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEM
HQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIRAFVALGAPWGGVAKTWRVLASGD
NNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSSEKVFVHTPTTNYTLRDYHQFFQDIGF
KDGWFMRQDTEGLVEATVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVN
LQSALQCQAWRSRQEPQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcgcctctgtccctaccacgcggcgctgctcccgggtggcgtcctgttcctc
ctgctgctggcagacccggcgctcccggttggacgtccccctccggtggtgttggtgccc
ggtgatttgggcaaccagctggaggcaaagctagacaagccaacggttgtgcactacctc
tgctccaagaggacagacagctacttcacactctggctgaacctcgaactgctgctgcct
gtcatcattgactgctggattgacaatatcaggctgatctataacagaacgtcccgggcc
acccagttcccagatggtgtggatgtgcgcgtccctggctttgggaagactttctcacta
gagttcctggaccccagcaaaagcagtgtgggctcctatttccataccatggtagagagc
cttgtaggctggggctacacacggggggaggatgtccggggggccccctacgactggcgc
cgagccccaaatgaaaacgggccctacttcctggccctccgggagatgatcgaggagatg
caccagctgtacgggggccctgtggtgctggttgcccacagcatgggcaacatgtacaca
ctctactttctgcagcgacagccccaggcctggaagaacaagtatatccgtgcgtttgtg
gcactgggtgcgccctgggggggcgtggccaagacttggcgtgtcctggcctcaggagac
aacaatcggatcccggtcatcaggcccttgaagatcagggagcagcagcggtctgccgtc
tccaccagctggctgctgccttacaactacacctggtcatctgaaaaggtcttcgtgcac
acacccacaaccaactacacactgcgggactatcaccagttcttccaggacatcggcttc
aaagatggctggttcatgcggcaggacacagaggggctggttgaagccacggtgccacct
ggtgtgcccctgcactgcctctatggcactggggtccccacgccagactccttctactac
gagagcttcccggaccgcgatcccaaaatctgctttggtgatggcgacggcactgtgaac
ttgcagagtgccctgcagtgccaggcctggcgcagccgccaggagccccaagtgtcattg
caggcgctgccgggcagcgagcacatagagatgctggccaatgccaccaccctggcctat
ctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system