KEGG   Ailuropoda melanoleuca (giant panda): 100477335Help
Entry
100477335         CDS       T01329                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aml00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aml04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 408 aa AA seqDB search
MGLRLCPYHAALLPGGVLFLLLLADPALPVGRPPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLIYNRTSRATQFPDGVDVRVPGFGKTFSL
EFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEM
HQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIRAFVALGAPWGGVAKTWRVLASGD
NNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSSEKVFVHTPTTNYTLRDYHQFFQDIGF
KDGWFMRQDTEGLVEATVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVN
LQSALQCQAWRSRQEPQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcgcctctgtccctaccacgcggcgctgctcccgggtggcgtcctgttcctc
ctgctgctggcagacccggcgctcccggttggacgtccccctccggtggtgttggtgccc
ggtgatttgggcaaccagctggaggcaaagctagacaagccaacggttgtgcactacctc
tgctccaagaggacagacagctacttcacactctggctgaacctcgaactgctgctgcct
gtcatcattgactgctggattgacaatatcaggctgatctataacagaacgtcccgggcc
acccagttcccagatggtgtggatgtgcgcgtccctggctttgggaagactttctcacta
gagttcctggaccccagcaaaagcagtgtgggctcctatttccataccatggtagagagc
cttgtaggctggggctacacacggggggaggatgtccggggggccccctacgactggcgc
cgagccccaaatgaaaacgggccctacttcctggccctccgggagatgatcgaggagatg
caccagctgtacgggggccctgtggtgctggttgcccacagcatgggcaacatgtacaca
ctctactttctgcagcgacagccccaggcctggaagaacaagtatatccgtgcgtttgtg
gcactgggtgcgccctgggggggcgtggccaagacttggcgtgtcctggcctcaggagac
aacaatcggatcccggtcatcaggcccttgaagatcagggagcagcagcggtctgccgtc
tccaccagctggctgctgccttacaactacacctggtcatctgaaaaggtcttcgtgcac
acacccacaaccaactacacactgcgggactatcaccagttcttccaggacatcggcttc
aaagatggctggttcatgcggcaggacacagaggggctggttgaagccacggtgccacct
ggtgtgcccctgcactgcctctatggcactggggtccccacgccagactccttctactac
gagagcttcccggaccgcgatcccaaaatctgctttggtgatggcgacggcactgtgaac
ttgcagagtgccctgcagtgccaggcctggcgcagccgccaggagccccaagtgtcattg
caggcgctgccgggcagcgagcacatagagatgctggccaatgccaccaccctggcctat
ctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system