KEGG   Ailuropoda melanoleuca (giant panda): 100477427Help
Entry
100477427         CDS       T01329                                 

Gene name
XRCC4
Definition
(RefSeq) X-ray repair complementing defective repair in Chinese hamster cells 4
  KO
K10886  
DNA-repair protein XRCC4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100477427 (XRCC4)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100477427 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 228 aa AA seqDB search
FRLGSFNLEKVASPASVIRKLICDCLDTITENQAKNEHLQKENERLLRDWNDVQGRFEKC
VSAKEAVETDLYKRFILVLNEKKAKIRSLHKLLSEVQEPEKNIEHERETTTCSEMTADRD
AIYDESTDEESENLPDPSVLAQATLRGDDSIISSPDVMDIAPSRKRRQRMQKNLGTEPKV
ASQVHGPQEKEKLGPPLPETSKKEHSSAENMSLETLRNSSSEDLFDEF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttcagacttggttccttcaatctagagaaagttgcaagtccagcttcagtcattagaaaa
cttatttgtgattgcctggacaccatcacagaaaaccaagcgaaaaatgagcacctgcag
aaggaaaatgaaaggcttctgcgagattggaatgatgttcaaggacgatttgaaaaatgt
gtgagtgctaaggaagctgtggagactgatctttataaacgatttatcctggtgctgaat
gagaagaaagcgaagattagaagcttgcataaattgttaagtgaagttcaagaaccagaa
aagaacattgagcatgaaagggaaaccacaacatgttctgaaatgactgctgacagagat
gcaatctatgatgaaagcactgatgaggaaagtgaaaacctgcctgatccctctgtgtta
gctcaagctactttaagaggagatgattccattatttcaagtcctgatgtcatggatatt
gcaccaagtagaaagaggaggcagcggatgcaaaagaatcttgggacagaacctaaagtg
gcttctcaggttcatgggcctcaagaaaaggagaagcttggtcctccactgcctgagacg
tcaaaaaaggagcacagctcagctgaaaacatgtctttagaaactctaagaaacagtagt
tcagaagacctctttgatgagttttaa

DBGET integrated database retrieval system