KEGG   Ailuropoda melanoleuca (giant panda): 100477427Help
Entry
100477427         CDS       T01329                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100477427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 228 aa AA seqDB search
FRLGSFNLEKVASPASVIRKLICDCLDTITENQAKNEHLQKENERLLRDWNDVQGRFEKC
VSAKEAVETDLYKRFILVLNEKKAKIRSLHKLLSEVQEPEKNIEHERETTTCSEMTADRD
AIYDESTDEESENLPDPSVLAQATLRGDDSIISSPDVMDIAPSRKRRQRMQKNLGTEPKV
ASQVHGPQEKEKLGPPLPETSKKEHSSAENMSLETLRNSSSEDLFDEF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttcagacttggttccttcaatctagagaaagttgcaagtccagcttcagtcattagaaaa
cttatttgtgattgcctggacaccatcacagaaaaccaagcgaaaaatgagcacctgcag
aaggaaaatgaaaggcttctgcgagattggaatgatgttcaaggacgatttgaaaaatgt
gtgagtgctaaggaagctgtggagactgatctttataaacgatttatcctggtgctgaat
gagaagaaagcgaagattagaagcttgcataaattgttaagtgaagttcaagaaccagaa
aagaacattgagcatgaaagggaaaccacaacatgttctgaaatgactgctgacagagat
gcaatctatgatgaaagcactgatgaggaaagtgaaaacctgcctgatccctctgtgtta
gctcaagctactttaagaggagatgattccattatttcaagtcctgatgtcatggatatt
gcaccaagtagaaagaggaggcagcggatgcaaaagaatcttgggacagaacctaaagtg
gcttctcaggttcatgggcctcaagaaaaggagaagcttggtcctccactgcctgagacg
tcaaaaaaggagcacagctcagctgaaaacatgtctttagaaactctaagaaacagtagt
tcagaagacctctttgatgagttttaa

DBGET integrated database retrieval system