KEGG   Ailuropoda melanoleuca (giant panda): 100477428Help
Entry
100477428         CDS       T01329                                 

Gene name
NSD1
Definition
nuclear receptor binding SET domain protein 1
Orthology
K15588  
histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100477428 (NSD1)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100477428 (NSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 2699 aa AA seqDB search
MDQTCELSRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTASGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQSPIVCTSLSPGG
PTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNVTCNYEPKSENGVDVAMGNEQDSTPESRHGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNVTIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRRCVTSSVKLDSEEDMPFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSMKKGHMQFEAHKEDRRGKIPENLGLNFISG
DVSDKQASNELSRIANSLTGSNTAPGSFLFSSCAKNTAKKEFETSNCDSLLGLSEGALIS
KRSGEKKKLQRGLVCSSKMQLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIDHSSESDN
SVLEITDAFDRTENMLSVQKNEKVKYTRYPATNTKVKAKQKSLITNSHTDNLMDCTKGAE
PGTETSQVNLSDLKVSTVVRKPQSDFRNDGFSPKFNTPSSISSENSLIKGGATNQALLHS
KSKQPKIRSIKCKHKENPVVVEPPVTNEDCSLKCCSSDTKGSPLASISKSGKVDGLKLLS
NMHEKTRDSNDIETAVVKHVLSELKELSYRSLSEDVSDSGTSKPSKPLLFSPASGQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGLGDCSTSSPVGASKVLVSGS
STHSSEKSGDGTQNPVRPSPSGGDSAVSGELSVSVPGLVSDRRDVPASSKSRSNCVTRRN
CGRSKPSSKLRDSFSAQMGKNTLNRKALKTERKRKLNRLPAVTLEAALQGDRASGGSENG
SSRSGLEDPGKEAPLQLMGHLTSEDSAHFSSVHFDNKVNQSDSDKIPEKGPPFENRKGPE
VDTEMNSENDEPSGVNQAVPKKRWQRLNQRRTKPRKRTNRFREKENSEGAFGVLLPADPI
KKGDEFPEHRPPPSTNILEGTLVDPNHASRLDSVGPRLNICDKSSVSIEKMEKEPGIPSL
TPQPELPEPAVRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEEES
LLARCRSSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVP
VAPEVSPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCY
EAGHLENDINESRNASHSKEYGGGTTKIFDKPRKRKRQRHAAAKVYCKKMKNDDSSKETL
TSEGELMTHRTAASPKETVEEGVENDHGMPASKKLQGERGGGAALKENVCQNCEKLGELL
LCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYH
EECVQKYPPTVMQNKGFRCSLHICITCHAANPASVSASKGRLMRCVRCPVAYHANDFCLA
AGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNI
DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPV
LFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQ
LQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDDNPCGIDSECINRML
LYECHPTVCPAGGRCQNQCFTKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELI
DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNG
DTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKS
KKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGK
WECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPG
EIREYVPPPVPLPPGPGTHLAEHSSGVAAQGPKMLDKLPADTNQTLSLSKKALAGTCQRP
PLPERPSDRTDSRPQPVDRVRDLAGSGTKPQSLVSSQKPLDRPPAVAGPRPQLSDKPSSV
TGVSSSPSVRSQPLERPLGTADPRLDKSIGAISPRPQSLEKTPVPTGLRLPPPDRLLVTS
GPKPQTSDRPPDKSHASLSQRLPPPDKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVM
DLIDLTPHQKERAASPHEVTPQVDEKMPVLESSSWTASKGLGQMPRAVERGSVSDPVLQP
PGKAAVPSEHSWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRAPAGVEQTPGPPSQAPG
LVKQVKQMAGGQQLPGLAAKSGQSFRPLGKAPSSLCTEEKKLATAEQSPWALGKASPGLW
PMVAGQTISPSCWSSGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSSHKCAESEQK
NT seq 8100 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacctgtgaactatctagaagaaattgtctgctgcccttttccaatccagtg
aatttagatgcccctgaagacaaggacagccctttcggtaatggtcaatccaatttttct
gagccacttaatgggtgtactatgcagttatcgactgccagtggaacatcccaaaatgct
tatggacaagattcaccatcttgttacattccactgcggagactacaggatttggcctcc
atgatcaatgtagagtatttaaatgggtctgctgatggatcagaatcctttcaagaccct
gaaaaaagtgattcaagagctcagtcgccaattgtttgcacttccttgagtcctggtggt
ccaacagcacttgctatgaaacaggaaccctcttgtaataactcccctgaactccaggta
aaagtaacaaagactatcaagaatggctttctgcactttgagaattttacttgtgtggac
gatgcagatgtagattctgaaatggacccagaacagccagtcacagaggatgagagtata
gaggagatctttgaggaaactcagaccaatgtcacctgcaattatgagcctaaatcagag
aatggtgtagacgtggccatgggaaatgaacaagacagcacaccagagagtagacacggt
gcagtcaaatcgccattcttgccattagctcctcaaactgaaacacagaaaaataagcaa
agaaatgaagtggacggcagcaatgaaaaagcagcccttctcccagcccccttttcacta
ggagatacaaacgttaccatagaagagcaattaaactcaataaatttatcttttcaggat
gatccagactccagtaccagtacattaggaaacatgctagaattacctggaacttcatca
tcatctacttcacaggaattgccattttgtcaacccaagaaaaagtctacgccactgaag
tatgaagttggagatctcatctgggcaaaattcaagagacgcccatggtggccctgcagg
atttgttctgatccgttgattaacacacattcaaaaatgaaagtttcaaaccggaggccc
tatcgacagtactacgtggaggcttttggggacccttcagagagagcctgggtggctgga
aaagcaatcgtcatgttcgaaggcagacatcaatttgaagagctacctgttcttaggaga
agagggaagcaaaaagaaaaaggatataggcacaaggttcctcagaaaattttgagtaaa
tgggaagccagtgttggtcttgctgaacagtatgatgttcccaaagggtcaaagaaccga
agatgtgtcaccagttcagtcaagttggacagtgaggaggatatgccatttgaggactgt
acaaatgatcctgaatcagagcatgacctgttacttaatggctgcttgaaatctctggct
tttgactctgaacattctgccgatgagaaggaaaagccttgtgctaagtctcgagccaga
aagagttctgataatccaaaaaggactagtatgaaaaagggccacatgcaatttgaagca
cataaggaagatcgaaggggaaagattccagagaaccttggcctaaactttatttctggg
gatgtatctgataagcaagcctctaatgaactttccaggatagccaacagtctcacaggg
tccaacactgccccaggaagtttcctgttttcttcttgtgcaaaaaacacagcaaagaaa
gaatttgagacttcaaattgtgactctttactgggcttgtctgagggtgccttgatctct
aaacgttctggggagaagaagaaactccaacgaggtttggtgtgtagttcaaaaatgcag
ctctgttatattggagcaggtgatgaagaaaagcgaagtgattccattagtatctgtacc
acttctgatgatggaagcagtgatctggatcccatagatcacagttcagagtctgataac
agtgtccttgaaattacagatgcttttgatagaacagagaacatgttatctgtgcagaaa
aatgaaaaggtaaaatatactaggtatcctgccacaaacactaaggtaaaagcaaagcag
aagtccctcattaccaactcccatacagacaacttaatggattgtactaagggagcagag
cctggaactgagacatctcaggttaatctctctgatcttaaggtatctactgttgttcgc
aaaccccagtcagattttagaaatgatggtttctctccaaaattcaacacaccatcaagc
atttccagtgagaactcactaataaaaggtggggctacaaatcaagctctattacattca
aaaagcaaacagcccaagatccgaagtataaagtgcaaacataaagaaaatccagttgta
gtggaacctccagttacaaatgaggactgcagtttgaaatgctgctcttctgataccaaa
ggctctcctttggccagcatttccaaaagtgggaaagtggatgggctaaaactactgagc
aacatgcatgagaaaaccagggattcaaatgacatagaaacagccgtggtgaaacatgtt
ctgtcagagttgaaggaactctcttatagatccttaagtgaggatgtgagtgactctgga
acatcaaagccatcaaaaccattacttttttctcctgcctctggtcagaatcatatacct
attgaaccagattacaaattcagtacattgttaatgatgttaaaagatatgcatgatagt
aagaccaaggagcaacggttaatgactgctcagaacttggtctcttatcggagtcccggt
cttggggactgttctacgagtagtcctgtaggtgcatctaaggtcttggtttcaggaagc
tccactcacagttcagaaaaaagtggagatggcactcagaacccagtccgtcctagccct
agtgggggtgactctgcagtgtctggagagttgtctgtatctgtacctggcttagtatct
gacagaagagacgtccctgcttctagtaaaagtcgttcaaactgtgttactaggcgcaac
tgtggtcgatcaaaaccatcatctaaattgcgagacagtttttcagcccagatgggaaag
aacacattgaaccgtaaagccttaaagacagagcgcaaaagaaaactcaaccgacttcca
gctgtaactcttgaggccgcactgcagggagacagagcaagtgggggttcagagaatggc
tcctcaagaagtgggctagaagaccctggtaaagaggcaccccttcagttaatgggccat
ttaacaagtgaagacagtgcccatttttccagtgttcattttgataacaaagtcaaccag
tctgactctgataaaattcctgagaaaggccctccttttgaaaacagaaagggcccagag
gtggataccgaaatgaacagtgagaatgatgaacccagtggtgtaaatcaggcggtgcct
aaaaagcggtggcagcgtttaaaccaaaggcgcactaaacctcgtaagcgcactaacaga
tttagagagaaagaaaactctgagggtgcttttggggttttgcttccagctgaccccata
aagaagggggatgagttcccagagcatagaccgcctccttcaacaaacatactagagggt
acgctggtagatccaaatcatgccagccgcttagattcagttggaccacggttgaacatt
tgtgataaatccagtgtgagcattgaaaagatggaaaaagagccgggaattcccagtttg
acaccgcagcctgagctccctgaaccagctgtgcggtcagagaagaaacgccttaggaag
ccaagcaagtggcttctggaatatacagaagaatatgatcagatatttgctcctaagaaa
aaacaaaagaaggtgcaggaacaggtacacaaggtaagttcccgctgtgaagaggaaagc
cttttagcccgatgtcgatctagtgctcagaacaagcaggtggatgagaattctttgatt
tcaaccaaagaagagcctccagttcttgaaagggaggctccatttttggaagggcccttg
gctcagtcagaacttggaggtggacatgctgagttgccacagctgaccttgtctgtgcct
gtggctccggaagtctctccacggcctgcccttgagtctgaggaattgctagttaaaaca
ccaggaaattatgaaagtaaacgtcagagaaaaccaactaagaaacttcttgaatccaat
gatttagaccctggatttatgcccaagaaaggggaccttggcctttctaaaaagtgttat
gaagctggccacttggagaatgacattaatgaatcacgtaatgcatctcattctaaagag
tatggtggaggcactaccaagatatttgataaaccaaggaagcgaaaacgacagaggcat
gctgcagccaaggtgtactgtaaaaaaatgaaaaatgacgactcatcaaaagaaactctg
acctcagagggagaactgatgacacacagaacggctgcaagccccaaggagactgttgag
gagggtgtagagaacgatcatgggatgccggcatctaaaaagctgcagggcgaacgaggc
ggaggagctgcactcaaggagaatgtttgtcagaactgtgagaaactgggtgagctgctg
ttgtgtgaggctcagtgctgtggggctttccacctggagtgccttggattaactgagatg
ccgagaggaaaatttatctgcaatgaatgtcgcacaggaatccatacctgttttgtttgt
aagcagagtggggaagatgttaaaaggtgccttttgcccttgtgtggaaagttttaccat
gaagaatgtgtccagaagtatccacccactgtcatgcagaacaagggcttccggtgctcc
cttcacatctgtataacctgccatgctgctaatccagccagtgtttctgcatctaaaggt
cgtctgatgcgctgtgtccgctgccctgtggcataccatgccaatgacttttgcctggct
gccgggtccaagattcttgcatctaatagtatcatctgccctaatcactttacacctagg
cggggctgccgaaatcacgagcatgttaatgttagctggtgttttgtatgctcagaagga
ggcagccttctgtgctgtgattcttgccctgctgcttttcatcgtgaatgcctgaacatt
gatatccctgaaggaaactggtattgcaatgattgtaaggcaggcaaaaagccacattac
agggaaattgtctgggtaaaagttggacgatacaggtggtggccagctgagatctgccat
cctcgagctgtaccttccaatatcgataagatgagacatgatgtgggcgagttccctgtg
ctcttctttgggtctaatgactatctgtggacgcatcaggcccgagtctttccctatatg
gagggggatgtgagcagcaaggataagatgggcaaaggagtggacgggacatataaaaaa
gctcttcaggaagctgcagcaagatttgaggagttaaaggcccaaaaagagctaagacag
ctgcaggaagaccgaaagaatgacaagaagccgccaccttacaaacatataaaggtgaac
cgtcctattggcagggtacagatcttcactgcagacttgtctgaaattccccgttgcaac
tgtaaagctactgatgataacccctgtgggatagactctgagtgcatcaatcgcatgctg
ctctatgagtgccaccccacagtatgtcctgccggaggacgttgccaaaaccagtgcttc
actaagcgccagtatccagaggttgaaattttccgcacattacagaggggctggggtctc
cggacaaaaacagatattaaaaagggtgaatttgtgaatgagtatgtgggtgagctaata
gatgaagaagagtgcagagctcgaatccgttatgcacaagaacatgatatcactaatttc
tatatgcttactctagacaaagaccggatcattgacgctggtcccaaaggaaactatgct
cggttcatgaatcattgctgccagcccaactgtgaaacacagaaatggtctgtgaatgga
gatacccgtgttggcctttttgccctgagtgatattaaagcaggcactgaacttaccttc
aactacaacctagaatgtcttgggaatggaaagactgtttgcaaatgtggagccccaaac
tgcagtggctttttgggtgtaaggccaaagaatcaacccattgccacagaagaaaagtca
aagaaattcaagaagaagcaacagggcaagcgcaggacccagggtgaaatcacaaaggag
cgagaggatgagtgtttcagctgtggggatgctggccagctcgtctcttgtaagaagcca
ggctgcccaaaagtttaccatgctgactgtctgaatctaaccaagcgaccagcagggaaa
tgggagtgtccttggcatcagtgtgacatctgtgggaaggaagcagcctccttctgtgag
atgtgtcccagctccttttgtaagcagcatcgggaagggatgctcttcatctccaaattg
gatgggcgtttgtcttgtactgagcatgacccctgcgggcccaaccctctggaacctggg
gagatccgtgagtatgtgcctcccccagtaccgctgcctccaggcccaggcactcacctg
gcagagcattcgtcaggagtggctgctcaggggcccaagatgttggataagctgcctgct
gacaccaaccagacactgtcattgtccaaaaaagctctggcagggacttgtcagaggcca
ccgcttcctgaaagaccttctgacagaactgactccaggccccagcctgtagatagggtc
agggaccttgctgggtcggggaccaaaccccaatccttggtatccagccagaagccattg
gacaggccacctgcagtggcaggaccaagaccccaactatctgacaaaccctcttcagtg
actggcgtaagttcctcaccctcagtcaggtcccaaccactggaaagacctctggggaca
gctgacccaaggctggataaatccataggtgctatcagcccaaggccccagtcactggag
aaaaccccagtccctactggcctgagacttccaccgccagacagactgctagtcaccagc
ggtcccaaaccccagacttcagacaggcccccagacaaatcccatgcttctttgtcccag
agactcccacctcctgacaaagtactatcagctgtggtccagaccctggtagctaaagaa
aaagcactgaggcccgtggaccagaatactcagtcaaaaaatagagctgctttggtgatg
gatctcatagacctaactcctcaccagaaagaacgggctgcttcacctcatgaggtcaca
ccacaggttgatgagaagatgccagtgttggagtcaagctcgtggactgccagcaaaggt
cttgggcaaatgccgcgagctgtagagagaggcagtgtgtcagatcctgtccttcagcca
ccagggaaagcagcggtaccttcggagcactcctggcaagcggttaaatcactcacccag
gccagacttctctctcagccccctgccaaggcttttttatatgagccaacaactcaggcc
tcaggaagagcacctgcaggggtggagcagacaccagggcctcccagccaagcaccgggc
ctggtgaagcaggtgaagcagatggctggaggccagcaactacctggacttgctgccaag
agtgggcagtccttcaggcctcttgggaaggccccatcctccctctgtactgaagaaaag
aaattggcaactgcagagcagagtccctgggccctgggaaaggcctcaccagggctctgg
cccatggtggctggacagacaatatcgccatcttgctggtcctctgggagcacacagaca
ttggcacagacttgctggtctcttggaagagggcaagaccctaagccagagcaaaataca
cttccagctcttaaccaggctccttccagtcacaagtgtgcagagtcagaacagaagtaa

DBGET integrated database retrieval system