KEGG   Ailuropoda melanoleuca (giant panda): 100477535Help
Entry
100477535         CDS       T01329                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 547 aa AA seqDB search
MKQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTRTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKTLK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaagcggaaaggagatctcagccctgccgagctgatgatgctgactatagga
gatgttattaaacaactgattgaagcccacgaacaggggaaagacatcgacctgaataag
gtaaaaaccaggacagctgccaaatatggcctttcagcacagccccgcctggtggatatc
atcgctgcagtcccacctcagtatcgaaaggtcttagtccccaaattaaaggcaaaaccc
atcagaactgccagtgggattgctgttgtggctgtgatgtgcaaaccccacagatgccca
cacatcagttttacaggaaatatatgcgtatactgtcccggtggacctgattcagatttt
gaatattcaacccagtcttatactggatatgagccaacctccatgcgagctatccgtgcg
aggtatgacccttatctacagacaagacaccgaatagaacagttaaaacaacttggtcac
agtgtggataaagtggagtttattgtgatgggtggaacatttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacctccaacaat
atttacgaggcagtcaagtattctgagagaagcctcacaaagtgtatcggaattactatt
gagaccagaccagattattgtatgaagcggcatttaagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtctacgaagatgtggccagagataccaacagg
ggccacactgtgaaggcagtatgtgagtcgtttcaccttgccaaggattctggtttcaaa
gtcgtggctcatatgatgcctgatctgccaaatgtgggactagagagagacattgaacag
ttcacagagttttttgagaaccctgcttttcgtcctgatggtttgaaactctaccctacc
ctggtaattcgtggaactgggctttatgagctatggaaatcaggaagatataagagttat
tctcctagcgacctgattgaattggtggctcggatccttgctcttgtgcctccatggact
cgagtgtaccgagtgcagagagatattccaatgcccttagtcagttcaggagtagagcat
ggtaatttgagagagctggcatttgcaagaatgaaagaccttggaatacagtgtcgagat
gtaagaaccagagaggttggaatccaagaaattcatcacaaagtacggccctaccaggtt
gaattggtaaggagagattatgttgcaaatggtggctgggaaacattcttatcttatgaa
gacccagatcaagacatattgattggcctcctgcgattacgaaagtgttcagaggaaacc
ttccgatttgaactggttggaggtgtttccatagttcgagagctgcatgtgtatggaagt
gtagtccctgtgagcagtcgagatcctactaaatttcagcatcagggatttggcatgctg
ctgatggaggaggcagaaagaatagctagagaagaacacggatctgggaaaatagctgtt
atatcaggggtcggcaccaggaattactaccgaaagattggctacagattacaagggccg
tacatggtaaagacgctaaagtag

DBGET integrated database retrieval system