KEGG   Ailuropoda melanoleuca (giant panda): 100477725Help
Entry
100477725         CDS       T01329                                 

Definition
histone deacetylase 1-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100477725
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100477725
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100477725
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100477725
   05202 Transcriptional misregulation in cancers
    100477725
   05203 Viral carcinogenesis
    100477725
   05220 Chronic myeloid leukemia
    100477725
  Neurodegenerative diseases
   05016 Huntington's disease
    100477725
  Substance dependence
   05034 Alcoholism
    100477725
  Infectious diseases
   05169 Epstein-Barr virus infection
    100477725
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100477725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNASNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcactaggaggaaagtctgttactactacgacggggatgttgga
aattactactatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcctgcgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
ccagtatttgatggcctgtttgaattctgtcagttatctactggaggctctgtggcgagt
gctgtgaaactgaataagcagcagacggacatcgctgtgaattgggccgggggcctgcac
catgcaaagaagtctgaggcatccggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggacattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatatctaaagtgatggagatgttccagcccagtgcggttgtcttacag
tgtggctctgactccctgtctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggagtttgtgaagagcttcaacctgcctatgctaatgctgggcgga
ggtggctacaccatccgtaacgtggcccgctgctggacgtacgaaacggcagtggccctg
gacacagaaatcccaaatgagcttccgtacaacgactacttcgaatactttgggccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaataccaatgaatacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgttcttctgacaagcgaattgcatgtgaggaagagttc
tcagactctgatgaggagggagaaggtggacgcaagaacgcttccaacttcaaaaaagcc
aagagagtcaaaactgaggacgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcttga

DBGET integrated database retrieval system