KEGG   Ailuropoda melanoleuca (giant panda): 100477951Help
Entry
100477951         CDS       T01329                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04024  cAMP signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04530  Tight junction
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05132  Salmonella infection
aml05133  Pertussis
aml05142  Chagas disease (American trypanosomiasis)
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05164  Influenza A
aml05167  Kaposi's sarcoma-associated herpesvirus infection
aml05168  Herpes simplex infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Module
aml_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100477951 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100477951 (MAPK10)
   04010 MAPK signaling pathway
    100477951 (MAPK10)
   04012 ErbB signaling pathway
    100477951 (MAPK10)
   04310 Wnt signaling pathway
    100477951 (MAPK10)
   04668 TNF signaling pathway
    100477951 (MAPK10)
   04068 FoxO signaling pathway
    100477951 (MAPK10)
   04071 Sphingolipid signaling pathway
    100477951 (MAPK10)
   04024 cAMP signaling pathway
    100477951 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100477951 (MAPK10)
   04137 Mitophagy - animal
    100477951 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    100477951 (MAPK10)
   04215 Apoptosis - multiple species
    100477951 (MAPK10)
   04217 Necroptosis
    100477951 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100477951 (MAPK10)
   04530 Tight junction
    100477951 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100477951 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100477951 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100477951 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100477951 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100477951 (MAPK10)
   04659 Th17 cell differentiation
    100477951 (MAPK10)
   04657 IL-17 signaling pathway
    100477951 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100477951 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100477951 (MAPK10)
   04920 Adipocytokine signaling pathway
    100477951 (MAPK10)
   04912 GnRH signaling pathway
    100477951 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100477951 (MAPK10)
   04917 Prolactin signaling pathway
    100477951 (MAPK10)
   04926 Relaxin signaling pathway
    100477951 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    100477951 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100477951 (MAPK10)
   04722 Neurotrophin signaling pathway
    100477951 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100477951 (MAPK10)
  Development
   04380 Osteoclast differentiation
    100477951 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100477951 (MAPK10)
   05231 Choline metabolism in cancer
    100477951 (MAPK10)
   05210 Colorectal cancer
    100477951 (MAPK10)
   05212 Pancreatic cancer
    100477951 (MAPK10)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100477951 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100477951 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100477951 (MAPK10)
   04931 Insulin resistance
    100477951 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100477951 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    100477951 (MAPK10)
   05133 Pertussis
    100477951 (MAPK10)
   05152 Tuberculosis
    100477951 (MAPK10)
   05164 Influenza A
    100477951 (MAPK10)
   05161 Hepatitis B
    100477951 (MAPK10)
   05160 Hepatitis C
    100477951 (MAPK10)
   05168 Herpes simplex infection
    100477951 (MAPK10)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100477951 (MAPK10)
   05169 Epstein-Barr virus infection
    100477951 (MAPK10)
   05145 Toxoplasmosis
    100477951 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    100477951 (MAPK10)
  Drug resistance
   01522 Endocrine resistance
    100477951 (MAPK10)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100477951 (MAPK10)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100477951 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100477951
NCBI-ProteinID: XP_019661813
Ensembl: ENSAMEG00000003514
UniProt: G1LA16
Position
Un
AA seq 464 aa AA seqDB search
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
cttaagcgctaccagaatttgaagcctattggctctggggctcagggaatagtttgtgct
gcgtacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacattggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggttacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggtttgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgaacaactagga
acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggatgacgccttacagcacccttacatcaat
gtgtggtacgaccctgccgaagtggaagcgcctccacctcagatttatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcggaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccgtcttcgtctgtcaacgacatctcctccatgtcc
actgaccagaccctggcatccgacactgacagcagcctggaagcctcagcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system