KEGG   Ailuropoda melanoleuca (giant panda): 100477974Help
Entry
100477974         CDS       T01329                                 

Gene name
LAMB2, LAMC1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 19
  KO
K06243  
laminin, beta 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100477974 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100477974 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100477974 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100477974 (LAMB2)
   05222 Small cell lung cancer
    100477974 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    100477974 (LAMB2)
   05145 Toxoplasmosis
    100477974 (LAMB2)
Cell adhesion molecules and their ligands [BR:aml04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100477974 (LAMB2)
   VLA-6
      100477974 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2170 aa AA seqDB search
MDRASGDRGRDLRGQPGPWELRLGLLLSVLATALAPDVPGCSRGSCYPATGDLLVGRADR
LTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRA
AWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYD
CGADFPGVPLAPPRHWDDIVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQNLLK
ITNLRVNLTRLHTLGDNLLDSRREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAPAH
AEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWRPAEDGHSHACRKCECHGHAHSCHFDMA
VYLASGNVSGGVCDGCQHDTAGRHCELCRPFFYRDPSKDLRDPAVCRSCDCDPMGSQDSG
RCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGYFGLSASDPAGCRRCQCDARGTVPGT
TSCDPNSGTCFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDVGGAMDPQCDEATGQC
RCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLATPSGTPSWTGRGFVR
LQEGQTLEFLVAAVPRAMDYDLLLRLEPQVPEQWAEMEVTVQRPGPVSAHSPCGHVLPKD
DHIPGTLQPETRYMVFPRPVCLEPGISYKLHLKLVRTGGSAQTEAPYSAPSLLIDSLVLL
PRVLVLEMFSGGDAAALERRATFERYRCHEEGLVPSKTPPSEACTPLLISLSTLLYNGAL
PCQCDPQGSLSSECNPHGGQCLCKPAVAGRRCDLCAPGFYGFGPTGCQACQCSPEGSLSG
LCEGTSGQCPCRTGAFGLRCDHCQRGQWGFPRCQPCVCNGHADECDTHTGACLGCRDHTG
GEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQIMCHCKAGYT
GLRCQENGQEPSPIALEPGPEPRRAKQEARNQKRAQGRGEVGAGAGPGAQAGPSAKRAVH
LRRGPEGEGSRDGPGPRGDAPPFLAETATQAEAEEQLRVPPLNPQTCLLGSEENLALLAG
EKTVSARSDPVSPAMARSRDPEKGDRSKEEMAVAADAITLVAGKEPESMVNLAFVKNDSY
EKGPDSVVVHVYVKEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKL
RNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAPRGAVGGAKVAVPTGPTPLDSTP
PGGTPHPLTGQEEARAVEKEKPKARSEDTGLDGVAARTPMEHVTPKPEPHLASPKPTCMV
PPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDR
SFEAEINYNNPLGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHD
AQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQG
QYKSKLVCPVCAKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSISKENS
SASEVLESLSQSVHVKSENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLPPELA
KERVVVLEVQQRPQVPSVPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPD
HKGLCRPENIGYPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQGPG
CTTLLSTSSLEAGDSERDLIQPPELQLVTPVAEGDAGVPRAWAAPDRGPVPSTSGVSSEV
LAGGPVEVGSLPASERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDASNREQRLEDKGD
TPLELGEDCSLALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFT
RPEVLAPEEAWYCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFP
VRNLDLSKFCIGQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLF
DDSTVTTVDESQVVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAEAAASQASRIW
QELEAEEEPVPEGPVPLGPWGPQDWVGPPPRGPTTPDEGCLRYFVLGTVAALVALVLNVF
YPLVSQSRWR
NT seq 6513 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggcctcaggggaccgagggagggacctgcggggacagcctgggccctgggag
cttcgactgggcctactgctgagtgtgctggccaccgccctggccccggatgtgccaggc
tgttcgaggggaagctgctaccctgccacaggtgacctgctagtgggccgtgctgacaga
ctgactgcctcatcgacctgtggcttgcacggcccccagccctactgcatcgttagtcac
ctgcaggatgagaagaagtgcttcctgtgtgactcccggcgccccttctctgctagagac
aacccaaacagccatcgcatccagaatgtagttaccagctttgcaccacagcgccgggca
gcctggtggcagtcagaaaatggtgtccccgtggtcaccatccagctggacttggaggct
gaatttcatttcacgcacctcattatgaccttcaagacatttcgtcctgctgccatgctg
gtggagcgctcagctgactttggacgcacctggcatgtgtaccgatatttttcctatgac
tgtggggctgactttccaggagtcccactggcccccccacggcactgggatgacatagtc
tgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgtgtg
ctggatcctgccatccctatcccagacccctatagcccacggatccagaacctgctgaag
atcaccaacctacgggtgaacctgacacggctgcatacactgggggacaacctgctggac
tcacggcgggagatccgtgagaaatactattacgccctctacgagctggttgtgcgtggc
aactgcttctgttatggacatgcctcgcagtgtgcacccgccccaggagctccagcccat
gctgagggcatggttcatggggcctgcgtctgcaaacacaacactcgtggcctcaactgt
gagcagtgtcaggatttctatcatgacttgccctggcgtccagccgaggatggccacagt
catgcctgcaggaagtgtgagtgccatgggcacgcccacagctgccatttcgacatggcc
gtatacctggcatctggcaacgtgagtggaggtgtgtgtgatggatgtcagcacgataca
gctgggcgccactgtgagctctgccgacccttcttctaccgtgacccaagcaaggacctg
cgggacccagctgtgtgccgctcctgtgattgtgaccccatgggttcccaagacagtggt
cgctgcgatccccatgatgatcctgctctggggctggtttcgggccagtgtcgctgcaaa
gaacatgtggtgggctctcgctgccagcaatgccgtgatggctactttgggctcagtgcc
agcgaccctgcaggctgccggcggtgtcagtgtgatgcacggggcacagtgcctgggacc
acctcctgtgaccccaacagtggaacctgtttctgcaagcgtctagtgactggacgtggc
tgtaaccgctgcctgcctggtcactggggcctgagccatgacctgcttggctgccgtccg
tgtgattgcgacgtgggtggtgccatggatccccagtgcgatgaggccacaggtcagtgc
cgctgtcgccagcacatggtggggcgacgctgtgagcaggtgcagcctggctacttccgg
cccttccttgaccacctaacctgggaggctgaggacacccgaggacaggtgctcgatgtg
gtggagcgcttggcgacccctagtgggactccatcctggacaggccggggctttgttagg
ctgcaggaaggtcagacactggagtttttggtggctgctgtgccaagagccatggactat
gacctgctgctgcgcttggagccccaggtccctgagcaatgggcagagatggaagtgacc
gtgcagcgcccagggcctgtgtctgcgcacagcccgtgtgggcatgtgctgcccaaggat
gaccacattccagggactctgcagccagaaaccaggtatatggtgtttcccagacctgtc
tgccttgagcctggcatctcctacaaactgcatctgaagctggtgcgaacagggggaagt
gcccagaccgaggctccctactccgcacccagcctgctcattgactcgctggtgctgctg
ccccgtgtcctggtgctggagatgtttagtgggggggatgctgctgccctggagcgccgt
gccacctttgagcgctaccgctgccatgaggaggggctggtgcccagcaagacccctccc
tctgaggcctgcacccccctcctcatcagcctgtccacgctactctacaacggcgccttg
ccctgtcagtgcgacccccagggctcactaagttccgagtgcaatccccacggcggccag
tgcctgtgtaaacctgcggtggcggggcgccgctgtgacctctgtgcccctggcttctac
ggctttggccccacaggctgtcaagcctgccagtgcagccccgaggggtcactcagtggc
ctgtgtgaagggaccagtgggcaatgcccctgccgaactggggccttcgggcttcgctgc
gatcactgccagcgtggccagtggggcttccctagatgccagccgtgtgtctgcaacggg
catgcagatgagtgcgacacccacacgggcgcttgcctaggctgccgtgatcacacaggg
ggtgagcactgtgaaaggtgcattgccggcttccacggggacccacggctaccatatggg
ggccagtgccggccctgtccctgccctgaaggccctggaagccggcggcactttgctact
tcttgccatcgggatggctactcgcagcagatcatgtgccactgtaaggcaggctacaca
gggctgcggtgccaggagaatgggcaggagccatctcccattgccctggagccaggccct
gagccccgtcgggctaaacaggaggcccggaaccagaagcgggcccagggccgtggtgag
gtaggcgcaggggctggccccggggcccaggcagggcccagcgccaagagggctgtgcat
ctccgcagagggccagagggggaagggtccagagatgggcctggaccccggggtgatgcc
ccccccttcttggctgagacagccacccaggctgaagctgaggaacagctccgggtacca
ccgctgaacccccagacctgcctcttgggctcagaggagaatctagcactcttggcagga
gagaagaccgtgtctgccaggagtgatccagtctccccagccatggcccggagcagagac
cctgagaaaggtgaccgttccaaagaagagatggcagtggcagcagatgctataaccttg
gtggctggtaaagagccggagtccatggtgaacctggcatttgtcaagaatgactcgtat
gagaaggggccagattcagtggtggtgcacgtgtacgtgaaagaaatccgcagggacact
tctcgagtgcttttccgcgagcaagacttcacacttatcttccagaccagggatggaaac
ttcttgagactgcaccctggctgtgggccccataccatcttccgttggcaggtgaagctc
aggaacctgattgagcccgagcagtgcaccttctgcttcacggcctctcgaattgacatc
tgcctccgtaagcggcaaagtcagcgctgggggggcctggaggccccagctccacgaggt
gcagtgggtggtgcaaaggttgccgtgccgacaggtccaacccctctggattcaacccca
ccgggaggtaccccccacccactcacaggccaggaagaagctcgggctgtggagaaggaa
aaacccaaggctcgatctgaggacacggggctggatggtgtggcagcccgcactcccatg
gagcatgtaaccccaaagccagagccacatctggcctcacccaagcccacatgtatggtg
cctccaatgccccacagccctgtgagtggagacagtgtggaggaagaggaggaggaagag
aagaaggtgtgtctgccaggcttcactggccttgtcaatcttggcaacacctgcttcatg
aacagtgtcattcagtctctgtctaacactcgggagctccgggacttcttccatgaccgc
tcctttgaggccgagatcaactacaacaacccactggggactggtgggcgtctggccatt
ggctttgctgtgctgcttcgggcgctgtggaagggcacccaccatgccttccagccttcc
aagttgaaggccattgtggcgagcaaggccagccagttcacaggctatgcacagcatgat
gcccaggagttcatggctttcttgctggatgggctgcatgaagacctgaatcgcattcag
aacaagccctacacagagaccgtcgactcggatgggcggccggatgaggtggtggctgaa
gaagcatggcagcggcataagatgaggaatgactctttcatcgtagacctatttcagggc
cagtataagtcgaagctggtgtgccccgtgtgtgccaaggtctccatcactttcgaccca
ttcctctacctgccggtgcccttgccgcagaagcagaaggttctccccgtcttctatttt
gcccgggagccccacagcaagcccatcaagtttctggtgagcatcagcaaggagaattcc
agcgcgagtgaagtgttggagtccctctctcagagtgtgcacgtgaagtctgagaacctc
cgtctggctgaggtgattaaaaatcgtttccaccgtgtgttcctgccctcccactcattg
gacactgtgtccccatccgacacgctcctctgctttgagctgctacccccagagttggct
aaggagcgggtggtggtgctagaggtgcaacagcgcccccaggtgcccagcgtccccatc
tccaagtgtgcagcctgccagcggaagcagcagtcagaggatgagaagctgaagcgctgt
acccggtgctaccgcgtgggctactgcaaccagctctgccagaaaacccactggcctgac
cacaagggtctctgccgccctgagaacattggctacccatttctggtcagtgtacctgcc
tcacgtctcacttacgctcgtctcgctcagctgctagagggctatgcccggtactctgtg
agtgtattccagccacccttccagcctggccgcatggccttggagtcccagggccccggc
tgtactacgttgctctccactagttccctggaggctggggacagtgagcgggacctgatt
cagccgcctgagctccagttggtgacccccgtggctgagggagacgcaggggtcccacgg
gcatgggcggcccctgaccggggccctgtgcccagcaccagtggcgtttcttctgaggtg
ctggccggtgggcctgttgaagttggttccttgcctgctagtgagagggtgtctcggcct
gaagctgctgtgcccggatatcagcacccaagtgaagccatgaatgcccacacaccccag
ttcttcatctataaaattgacgcatctaaccgagaacagcggctagaggacaaaggagac
acccccctggagctgggtgaggactgcagcctggcactagtctggcggaacaacgagcgc
ctgcaggagttcgtgttggtagcgtccaaggagctggagtgtgctgaggatccaggctct
gctggggaggctgcccgcgctggccacttcactctggaccagtgcctgaacctcttcacc
cggcctgaggtgctggcacccgaggaggcttggtactgcccacagtgtaaacaacatcga
gaggcttccaagcagctactgctgtggcgccttcctaatgtactcatcgtgcagctcaag
cgcttctcctttcggagtttcatctggcgtgacaagatcaatgacttggtggagttccct
gttcggaacctggacctgagcaagttctgcatcggtcagaaggaggaacagctgcctagc
tacgacctgtacgccgtcatcaaccactacggaggcatgatcggcggccactacaccgcc
tgtgcgcgcctgcccaatgaccgaagcagccagcgcagcgacgtgggctggcgcctgttt
gacgacagcacggtgacaacagtagacgagagccaggtcgtgacgcgttatgcctatgta
ctcttctaccgccggcggaactctcctgtggagaggccccccagggcaggtcactcagag
caccacccagacctaggccctgcagccgaggctgctgccagccaggcttcccggatttgg
caggagctggaggccgaggaggaaccggtacccgaggggcctgtgcccctgggtccctgg
gggccccaagactgggtgggccccccaccacgtggccctaccacaccagatgagggctgc
ctccggtactttgttctgggcaccgtggcagctttggtggccctcgtgctcaacgtgttc
tatcctctggtatcccagagtcgctggagatga

DBGET integrated database retrieval system