KEGG   Ailuropoda melanoleuca (giant panda): 100477974Help
Entry
100477974         CDS       T01329                                 

Gene name
LAMC1, LAMB2
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K06243  
laminin, beta 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:aml04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:aml04510]
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:aml05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:aml05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:aml05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1797 aa AA seqDB search
MDRASGDRGRDLRGQPGPWELRLGLLLSVLATALAPDVPGCSRGSCYPATGDLLVGRADR
LTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAPQRRA
AWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSYD
CGADFPGVPLAPPRHWDDIVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQNLLK
ITNLRVNLTRLHTLGDNLLDSRREIREKYYYALYELVVRGNCFCYGHASQCAPAPGAPAH
AEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWRPAEDGHSHACRKCECHGHAHSCHFDMA
VYLASGNVSGGVCDGCQHDTAGRHCELCRPFFYRDPSKDLRDPAVCRSCDCDPMGSQDSG
RCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGYFGLSASDPAGCRRCQCDARGTVPGT
TSCDPNSGTCFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDVGGAMDPQCDEATGQC
RCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLATPSGTPSWTGRGFVR
LQEGQTLEFLVAAVPRAMDYDLLLRLEPQVPEQWAEMEVTVQRPGPVSAHSPCGHVLPKD
DHIPGTLQPETRYMVFPRPVCLEPGISYKLHLKLVRTGGSAQTEAPYSAPSLLIDSLVLL
PRVLVLEMFSGGDAAALERRATFERYRCHEEGLVPSKTPPSEACTPLLISLSTLLYNGAL
PCQCDPQGSLSSECNPHGGQCLCKPAVAGRRCDLCAPGFYGFGPTGCQACQCSPEGSLSG
LCEGTSGQCPCRTGAFGLRCDHCQRGQWGFPRCQPCVCNGHADECDTHTGACLGCRDHTG
GEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQIMCHCKAGYT
GLRCDACAPGYFGDPSRPGGQCQPCECSGNIDPTDPDACDPRTGQCLRCLHHTEGPHCAH
CKPGFHGQAARQSCHRCSCNLLGTDPQQCPSADRCNCDPSSGQCPCLPNVQGPSCDRCAP
NFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQCR
ACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDRVV
QDLAARTRRLEQRVQELQQTGVLGAFESSFWHIQEKLGTVQGIVGARNASAASTAQLVEA
TEELRREIGEATEHLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLDQHLDLL
KHSNFLGAYDSIRHAHSLSAEAEHRANTSALTVPSPVSNSADTRHRTEVLMGAQREDFNR
KHMANQQALGELSARTHSLSLTAINELVCGPPGDAPCATSPCGGAGCLDEDGQPRCGGLG
CSGVVAMADLALGRARHTQAELQRALAEGGGILSHVAETRRQAGEAQQRARAALDKANAS
RGQVEKANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAGEIAE
RVRSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGAA
QGAIQGAVVDTQDTERTLHQVQEKMAGAEQALSSAGERAQQLDGLLEALKLKRAGNSLAA
SSAEETAGSAQGRAREAEQLLQGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARGL
LQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggcctcaggggaccgagggagggacctgcggggacagcctgggccctgggag
cttcgactgggcctactgctgagtgtgctggccaccgccctggccccggatgtgccaggc
tgttcgaggggaagctgctaccctgccacaggtgacctgctagtgggccgtgctgacaga
ctgactgcctcatcgacctgtggcttgcacggcccccagccctactgcatcgttagtcac
ctgcaggatgagaagaagtgcttcctgtgtgactcccggcgccccttctctgctagagac
aacccaaacagccatcgcatccagaatgtagttaccagctttgcaccacagcgccgggca
gcctggtggcagtcagaaaatggtgtccccgtggtcaccatccagctggacttggaggct
gaatttcatttcacgcacctcattatgaccttcaagacatttcgtcctgctgccatgctg
gtggagcgctcagctgactttggacgcacctggcatgtgtaccgatatttttcctatgac
tgtggggctgactttccaggagtcccactggcccccccacggcactgggatgacatagtc
tgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgtgtg
ctggatcctgccatccctatcccagacccctatagcccacggatccagaacctgctgaag
atcaccaacctacgggtgaacctgacacggctgcatacactgggggacaacctgctggac
tcacggcgggagatccgtgagaaatactattacgccctctacgagctggttgtgcgtggc
aactgcttctgttatggacatgcctcgcagtgtgcacccgccccaggagctccagcccat
gctgagggcatggttcatggggcctgcgtctgcaaacacaacactcgtggcctcaactgt
gagcagtgtcaggatttctatcatgacttgccctggcgtccagccgaggatggccacagt
catgcctgcaggaagtgtgagtgccatgggcacgcccacagctgccatttcgacatggcc
gtatacctggcatctggcaacgtgagtggaggtgtgtgtgatggatgtcagcacgataca
gctgggcgccactgtgagctctgccgacccttcttctaccgtgacccaagcaaggacctg
cgggacccagctgtgtgccgctcctgtgattgtgaccccatgggttcccaagacagtggt
cgctgcgatccccatgatgatcctgctctggggctggtttcgggccagtgtcgctgcaaa
gaacatgtggtgggctctcgctgccagcaatgccgtgatggctactttgggctcagtgcc
agcgaccctgcaggctgccggcggtgtcagtgtgatgcacggggcacagtgcctgggacc
acctcctgtgaccccaacagtggaacctgtttctgcaagcgtctagtgactggacgtggc
tgtaaccgctgcctgcctggtcactggggcctgagccatgacctgcttggctgccgtccg
tgtgattgcgacgtgggtggtgccatggatccccagtgcgatgaggccacaggtcagtgc
cgctgtcgccagcacatggtggggcgacgctgtgagcaggtgcagcctggctacttccgg
cccttccttgaccacctaacctgggaggctgaggacacccgaggacaggtgctcgatgtg
gtggagcgcttggcgacccctagtgggactccatcctggacaggccggggctttgttagg
ctgcaggaaggtcagacactggagtttttggtggctgctgtgccaagagccatggactat
gacctgctgctgcgcttggagccccaggtccctgagcaatgggcagagatggaagtgacc
gtgcagcgcccagggcctgtgtctgcgcacagcccgtgtgggcatgtgctgcccaaggat
gaccacattccagggactctgcagccagaaaccaggtatatggtgtttcccagacctgtc
tgccttgagcctggcatctcctacaaactgcatctgaagctggtgcgaacagggggaagt
gcccagaccgaggctccctactccgcacccagcctgctcattgactcgctggtgctgctg
ccccgtgtcctggtgctggagatgtttagtgggggggatgctgctgccctggagcgccgt
gccacctttgagcgctaccgctgccatgaggaggggctggtgcccagcaagacccctccc
tctgaggcctgcacccccctcctcatcagcctgtccacgctactctacaacggcgccttg
ccctgtcagtgcgacccccagggctcactaagttccgagtgcaatccccacggcggccag
tgcctgtgtaaacctgcggtggcggggcgccgctgtgacctctgtgcccctggcttctac
ggctttggccccacaggctgtcaagcctgccagtgcagccccgaggggtcactcagtggc
ctgtgtgaagggaccagtgggcaatgcccctgccgaactggggccttcgggcttcgctgc
gatcactgccagcgtggccagtggggcttccctagatgccagccgtgtgtctgcaacggg
catgcagatgagtgcgacacccacacgggcgcttgcctaggctgccgtgatcacacaggg
ggtgagcactgtgaaaggtgcattgccggcttccacggggacccacggctaccatatggg
ggccagtgccggccctgtccctgccctgaaggccctggaagccggcggcactttgctact
tcttgccatcgggatggctactcgcagcagatcatgtgccactgtaaggcaggctacaca
gggctgcggtgtgatgcttgtgcccctgggtactttggggacccgtcaaggccaggtggc
cagtgccaaccgtgtgagtgcagtggaaacattgaccccacggaccctgatgcctgtgac
ccccgcacggggcaatgcctgcgctgcttacaccacacggaggggccacactgtgcccac
tgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgctgcagctgcaac
ttgctgggtacagatccccagcagtgcccatccgctgaccgctgcaactgtgacccaagc
agtgggcagtgcccatgcctccccaatgtccagggccctagctgtgaccgctgtgccccc
aacttctggaaccttaccagtggccatggctgccagccctgtgcctgccacccaagccga
gccagaggccccacctgcaatgagttcacagggcagtgccactgccgtgctggctttggt
gggcgaacctgttctgagtgccaagagctccactggggagaccctgggttgcagtgccgt
gcctgtgattgtgaccctcgtggaatagacacacctcaatgtcaccgctccacagggcac
tgcagctgccgcccaggcgtgtcaggcgtgcgctgtgaccagtgtgcccgtggcttctca
ggggtctttcctgcttgccacccatgccacgcatgcttcggggactgggaccgcgtggta
caggacttggctgcccgtacacggcgcctggagcagcgggtgcaggagctgcagcagacg
ggtgtgctgggtgcctttgagagcagcttctggcacatacaggagaagctggggactgtg
cagggcattgtgggtgcccgcaacgcctcagctgcctccactgcacagctcgtggaggcc
acagaggagctgcggcgtgaaattggagaggccactgagcacctgacccagctggaggca
gaactgacagatgtgcaggatgagaacttcaatgccaaccatgcactgagcagtctggag
cgagacgggcttgcccttaatctcacactgcggcagctggatcagcatctggacctgctc
aagcattcaaacttcctgggtgcctatgacagcatccgccacgcccacagtctgtctgca
gaggcagaacatcgtgccaacacatcggccttgacagtgcccagccctgtgagcaactca
gcagatacccggcaccggacagaggtgctgatgggtgcccagagggaggacttcaaccgc
aaacacatggccaaccagcaggcactaggcgagctctctgcccgtacccattccctgagc
ctgacagccataaatgaactggtgtgtggacccccgggggatgccccctgtgctacaagc
ccttgtgggggtgctggctgtctggacgaggacgggcagccccgctgtgggggcctcggc
tgcagcggggtagtagccatggcagacctggcactgggtcgggcccggcacacacaagca
gagttgcagcgggcactggcagaaggtggtggcatcctcagccacgtggctgagacccgt
cggcaggcaggcgaggcacagcagcgggcccgggcagccctggacaaggctaatgcttcc
aggggacaggtggagaaggccaaccaagaactccgggaacttatccagagtgtgaaggac
ttcctcagccaggagggggctgatcctgatagcattgagatggtggccacacgagtgcta
gagctctccatcccagcatcacctgagcagattcagcacctggcaggagagattgcagag
agggtccggagcctggcggatgtggacacaatcctggcgcgtaccgtgggagatgtgcgt
cgggcagagcagctgctacaagatgcacggcgggcaaggagccgggccgagggggagaaa
cagaaggcagaaacagtacaggcagcactggaggaagcccagagggcacagggtgctgct
cagggtgccatccagggggcagtagttgacacacaggacacggagcggaccctgcaccag
gtgcaggagaagatggcaggtgcagagcaggcactgagctctgcaggcgagcgggctcag
caattggatggtctcctggaggctctgaaattgaaacgagcagggaatagcctggcagcc
tctagtgctgaagaaacagcaggcagtgcccagggtcgtgcccgggaagctgagcagctg
ctgcagggcccactaggtgaccagtaccagacagtgaaggccttggccgagcgcaaggcc
cagggtgtgctggctgcacaggcgcgggcagagcaacttcgggatgaggctcgaggcttg
ttgcaggctgctcaggacaagctgcaaaggctgcaagagctcgaggggacctatgaggag
aacgagcgggcactggaaggcaaagcagcccagctggacgggttggaggccaggatgcgt
agtgtgcttcaagccatcaacttgcaggtccagatctacaacacctgccagtga

DBGET integrated database retrieval system