KEGG   Ailuropoda melanoleuca (giant panda): 100478011Help
Entry
100478011         CDS       T01329                                 

Gene name
GFPT2
Definition
(RefSeq) glutamine-fructose-6-phosphate transaminase 2
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100478011 (GFPT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100478011 (GFPT2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100478011 (GFPT2)
Enzymes [BR:aml01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     100478011 (GFPT2)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C44
   100478011 (GFPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 682 aa AA seqDB search
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGHNNEVKERHIQLVKKR
GNVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTRNFENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRREIICGLQSLPGLIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSRDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcgcgtacatgaactacagagtcccccggacgaggaaggagattttc
gagaccctcattaagggccttcagaggctggagtaccgaggctacgactcggcaggtgtg
gccatcgatggacataataatgaagtcaaagaacgacatatccagttggtcaagaagaga
gggaatgtcaaggctcttgacgaggaactttacaaacaagacagcatggacttaaaggta
gagtttgagacccactttggcattgcccacacgcgctgggccacccatggggtccccaat
gctgtcaacagccatcctcagcgctcagacaaaggcaatgaattcgtggtcatccataac
gggatcatcacaaattacaaagacctgaggaagtttctggaaagcaaaggctacgagttt
gagtcagaaacagataccgagaccattgccaagctgattaaatatgtgtttgacaacaga
gaaactgaggacattacgttttcaacattggtcgaaagagtcatccagcagctggaaggc
gcgtttgcgttggttttcaagagcatccactacccgggagaagccgttgccaccaggaga
ggcagccccctgctcattggagtgcggagcaaatacaaactgtccacggaacagatcccc
atcttgtataggacgcgcaattttgagaatgtgaagaatatttgcaaaacgagaatgaag
aggctggacagctcgacctgccttcatgctgttggcgataaagccgtggaattcttcttt
gcttcagatgcaagtgccatcatagaacataccaaccgggtcatcttccttgaggatgac
gacatcgccgcagtggctgatgggaaactctccattcatcgggtcaagcgttccgctagt
gacgacccatctcgagccatccagaccttgcagatggaactgcagcaaatcatgaaaggt
aacttcagtgcgtttatgcagaaggagatctttgaacagccagagtccgttttcaacacc
atgagaggtcgggtgaattttgagaccaacacagtgctcctgggaggcctgaaggaccac
ttgaaggagatccggcgttgccgccggctcatcgtgattggctgtggaaccagctaccac
gccgccgtggccacacggcaggttttggaggagctgacggagctccctgtgatggttgaa
cttgcaagcgattttctggacaggaacacaccggtgttcagggatgacgtttgctttttc
atcagccagtcaggtgagactgcagacaccctgctggcgttgcgctactgtaaggaccgc
cgggccctgactgtgggtgtcaccaacaccgtgggcagctccatctcccgagagaccgac
tgcggtgtccacatcaatgcggggccagaaatcggcgtggccagtaccaaggcttacacc
agtcagttcatctccctggtgatgtttggtttgatgatgtccgaagaccgaatttcactg
caaaacagaaggcgagagatcatctgcggtttacagtctttacctgggctgatcaaggaa
gtgctgtcgctggatgagaagattcatgacctggccctggagctctacacacagaggtcg
ctcctggtcatgggacggggctataactacgccacgtgcctggaaggagccctgaaaatt
aaagagataacctacatgcattcggaaggcatcctggctggggagctgaagcacggaccc
ttagcactgattgacaagcagatgcccgtcatcatggtcatcatgaaggacccttgcttt
gccaaatgccagaacgccctgcagcaggtcacagcccgccagggtcgcccgattatactg
tgctccagggacgacactgagagttccaagttcgcgtataagacgatcgagctgccccac
acggtggactgcctccaggggatcctgagtgtgatcccgctgcagctcctgtcctttcac
ctggctgttctccgaggctatgacgtcgacttccccagaaatctggccaagtctgtgacc
gtggaatag

DBGET integrated database retrieval system