KEGG   Ailuropoda melanoleuca (giant panda): 100478011Help
Entry
100478011         CDS       T01329                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2-like
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aml00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aml00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 682 aa AA seqDB search
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGHNNEVKERHIQLVKKR
GNVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTRNFENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRREIICGLQSLPGLIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSRDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcttcgcgtacatgaactacagagtcccccggacgaggaaggagattttc
gagaccctcattaagggccttcagaggctggagtaccgaggctacgactcggcaggtgtg
gccatcgatggacataataatgaagtcaaagaacgacatatccagttggtcaagaagaga
gggaatgtcaaggctcttgacgaggaactttacaaacaagacagcatggacttaaaggta
gagtttgagacccactttggcattgcccacacgcgctgggccacccatggggtccccaat
gctgtcaacagccatcctcagcgctcagacaaaggcaatgaattcgtggtcatccataac
gggatcatcacaaattacaaagacctgaggaagtttctggaaagcaaaggctacgagttt
gagtcagaaacagataccgagaccattgccaagctgattaaatatgtgtttgacaacaga
gaaactgaggacattacgttttcaacattggtcgaaagagtcatccagcagctggaaggc
gcgtttgcgttggttttcaagagcatccactacccgggagaagccgttgccaccaggaga
ggcagccccctgctcattggagtgcggagcaaatacaaactgtccacggaacagatcccc
atcttgtataggacgcgcaattttgagaatgtgaagaatatttgcaaaacgagaatgaag
aggctggacagctcgacctgccttcatgctgttggcgataaagccgtggaattcttcttt
gcttcagatgcaagtgccatcatagaacataccaaccgggtcatcttccttgaggatgac
gacatcgccgcagtggctgatgggaaactctccattcatcgggtcaagcgttccgctagt
gacgacccatctcgagccatccagaccttgcagatggaactgcagcaaatcatgaaaggt
aacttcagtgcgtttatgcagaaggagatctttgaacagccagagtccgttttcaacacc
atgagaggtcgggtgaattttgagaccaacacagtgctcctgggaggcctgaaggaccac
ttgaaggagatccggcgttgccgccggctcatcgtgattggctgtggaaccagctaccac
gccgccgtggccacacggcaggttttggaggagctgacggagctccctgtgatggttgaa
cttgcaagcgattttctggacaggaacacaccggtgttcagggatgacgtttgctttttc
atcagccagtcaggtgagactgcagacaccctgctggcgttgcgctactgtaaggaccgc
cgggccctgactgtgggtgtcaccaacaccgtgggcagctccatctcccgagagaccgac
tgcggtgtccacatcaatgcggggccagaaatcggcgtggccagtaccaaggcttacacc
agtcagttcatctccctggtgatgtttggtttgatgatgtccgaagaccgaatttcactg
caaaacagaaggcgagagatcatctgcggtttacagtctttacctgggctgatcaaggaa
gtgctgtcgctggatgagaagattcatgacctggccctggagctctacacacagaggtcg
ctcctggtcatgggacggggctataactacgccacgtgcctggaaggagccctgaaaatt
aaagagataacctacatgcattcggaaggcatcctggctggggagctgaagcacggaccc
ttagcactgattgacaagcagatgcccgtcatcatggtcatcatgaaggacccttgcttt
gccaaatgccagaacgccctgcagcaggtcacagcccgccagggtcgcccgattatactg
tgctccagggacgacactgagagttccaagttcgcgtataagacgatcgagctgccccac
acggtggactgcctccaggggatcctgagtgtgatcccgctgcagctcctgtcctttcac
ctggctgttctccgaggctatgacgtcgacttccccagaaatctggccaagtctgtgacc
gtggaatag

DBGET integrated database retrieval system