KEGG   Ailuropoda melanoleuca (giant panda): 100478081Help
Entry
100478081         CDS       T01329                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100478081
   04152 AMPK signaling pathway
    100478081
   04150 mTOR signaling pathway
    100478081
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100478081
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100478081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEASELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLCSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDTPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVGRD
LPAGRPGAPGPAGVQYTPHSQQFPRTRKMFDKGPDQTTDDADDTAGHRSFVSATTQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRQQARQLIQKGIAKLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAVYSGSGELINHIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRAR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcccctcttttgggactcggggaggaagatgaggccgac
cttacagactggaacttgcctttggcttttatgaaaaagaggcactgtgagaaaatcgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacggtcagtgtt
gccttagtcttgtgcctgaatgttggcgtggaccccccggatgtggtgaagaccaccccc
tgtgcccgtctggagtgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcgaatttgcagaagcaatacgagaactggcagccgagggcccggtacaag
cagagcctcgacccgaccgtggacgaagtgaagaagctgtgcacgtccttgcgccgcaat
gccaaggaggagcgggtcctcttccactacaatggccacggggtgcccaggcccaccgtg
aacggggagatctgggtcttcaacaagaactacactcagtacatccctctgtctatatat
gacctgcagacgtggatgggcagcccatcgatattcgtctacgactgctccaacgctggc
ttgatcgtcaagtccttcaaacagtttgccttgcagagggagcaggagctggaggtcgcg
gccattaacccgaaccacccgctggcgcagatgcctctgcccccgtccatgaagaattgc
atccagctggctgcctgcgaggccagcgagctgctgcccatgatccccgacctcccggcc
gacctcttcacgtcctgcctcaccacccccatcaaaatcgccctgcgctggttttgcatg
cagaaatgcgttagtctggtgcctggggtcacactggatttaatagaaaagattcccggc
cggctaaatgaccggaggacccctctgggagaactgaactggatcttcacggcaatcaca
gacaccatcgcgtggaatgtgctccctcgggatctcttccaaaagctcttcagacaggac
ctgttggtggctagtctgtttcggaattttctcctggcagaaaggatcatgcggtcctac
aactgcacccccgtcagcagcccacgcctgccccccacttacatgcacgccatgtggcaa
gcctgggaccttgccgtcgacatttgcctctctcagctgcccaccatcatcgaggaaggc
accgcatttcggcacagtccgttctttgctgagcagctgaccgcattccaggtgtggctc
acgatgggcgtggagaacaggaacccacccgagcaacttcccattgttctgcaggtgctg
ctgagccaggtgcaccggctgagagccctggatttgctgggacgattcctggacctgggc
ccctgggcggtgagcctggccttgtctgtgggcattttcccctacgtgctgaaactgctc
cagagctcagccagagagctgcggcccctgctggtgttcatctgggccaagatcctggcc
gtggacagttcgtgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcg
gtcttggcagacccttacatgccagctgagcaccggaccatgacggctttcatcctcgcc
gtgattgtgaacagctacaacactggacaggaagcctgcctccagggaaacttgatcgcc
atctgcctggagcagctcaacgatccccacccactgctgcgccagtgggtggccatctgc
ctgggacgcatctggcagaactttgactcggccaggtggtgtggcgtgagggacagcgcg
cacgagaaactgtgcagcctcctctctgaccccatccctgaggtgcgctgtgcagcggtc
ttcgcccttggcacgtttgtgggcaactctgcggagaggaccgaccactcaaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaatgacgggagccccgtggtccgc
aaggagctggtggtggctctgagtcatcttgtcgttcagtatgaaagcaatttctgcacg
gtggccttgcagttcatggaggaggagaagaactaccccttgccttctccggcaaccaca
gagggtgggagtttgacccccgtgcgggacaccccgtgcacccccagactccgttccgtc
agctcctacggaaacattcgtgccgtcaccaccgccagaagcctgaacaaatctttgcag
aatctgagcttgacagaagaatcgggcagctcggtggcattctcgcccggaaacctcagc
acaagcagcagtgccagcagcaccttgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgccgcgtcagctcctactctgccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagttttactgcatctggctgca
gacccatatccagatgtttccgacttggccatgaaggtgctcaacagcattgcctacaag
gccacagtgaacgcccggccccagcgcatcctcaccacgtcctcgctcacccagtcagcg
cccgccagccccaccaacaagggcatccacatccaccaggcagggggctcccccccgaca
tccagcgccagcagctccagcctgaccaacgacgtcgcgaagcagccagtcggccgagac
ctgcccgcgggccgccctggcgccccgggccccgcaggggtgcagtacacaccccactcc
cagcagttcccccgcacgcggaagatgttcgacaagggcccagaccagaccaccgacgac
gcggatgacactgcaggacacagaagcttcgtctcggccacgacgcagaccggcttctgt
gactggagtgcccggtacttcgcccagcctgtcatgaagatcccagaagaacatgacctg
gagagccagatccgcaaggagcgggagtggcgatttcttcgcaacacgcgcgtcagacag
caggcgcgacagctcatccagaagggtatcgccaaactggacgaccagatatttctcaac
aggaatcccggcgtcccctccgtggtcaagttccacccctttacaccatgtgtggccgtg
gctgacaaagacagcatctgtttttgggactgggagaaaggggagaagctggattacttc
cacaacggaaaccctcggtacaccagggtcaccgccatggagtacctgaacggccaggac
tgctcgctgctgctcacggccacggatgatggtgccatcagagtctggaagaacttcgcg
gatttggaaaagaacccagagatggtgactgcttggcaggggctctcggacatgctgccc
acaaccagaggagccgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tccggggacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccccacgggtgctgacagctgcgtgaccagcctgtcctgcgactcccaccgctccctc
atcgtggctggcctcggcgatggctccatccgtgtctacgaccggaggatggcgctcagt
gaatgccgcgtcatgacctaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggggacgtgcgcttctttgac
cctcggatgccggagtctgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaacctgatcgcctgcggctccatgaaccagttcacggccgtctac
agcgggagcggggagctcatcaaccacatcaagtactacgacggctttatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggccgcacctggccgtggggagc
aacgactactacatctccgtgtactcggtggagaagcgcgccagatag

DBGET integrated database retrieval system