KEGG   Ailuropoda melanoleuca (giant panda): 100478149Help
Entry
100478149         CDS       T01329                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 912 aa AA seqDB search
MATLMAHGFVQIWSKRMGMSTSKEAYIKTVERKKIKLVVHFTTGENKTFQLSNNIKNVVL
RSYGKKQNHLHLTFQNNSFLFIEKLSSRDAKQLKMFLDRVHQNNIQPSVRPVKDGGIFAS
ITTPKVINKNSFHKARKKPSSGSFQTGEGSGTSDQKMPSFALKSSKPSCKDLLENGYGKR
KRMLSSGSEMNGKNPKKSNSVRKKKSQTNPLMHVSHSEKKKLRLRVLKKDKKLEFEPLIK
TVSPEKPPLDGKGFLQMLSEKMYLAFLLAPKYNADYPEWDKLKMTFDFYPEKLWQGLPNL
GNTCYMNAVLQSLFSIPSFADDLLSQDFPWGKIPLDALRMCLTQLFVLKNIYNIKIKKRL
LVNIKKAISTVAEIFSGNIQNDAHEFLGHCLDQMKENMGKLNTIWKMKIESEEDNSAQQV
FAGSAATRVLICPVITNFEFELLRSIICQACGQVVRKAEVSNYLSINLPQGMQALPLSIQ
SAFDLFFGAEELEYKCEKCQHRSSVAVHKFSRLPRVLIVHLKRYIFNQFWSLRKDDQEVV
ISKYLKLSSHCNESTKPPLPVSKNAHNRDFHILKVFQKMSAENLCLLAPSTKLTSASSLF
PVPHMGPDKEYEPQKCQILYKRSHNEQQKKDLEKCSRRNMTKSKLVNVGDGAVIEKELLA
PSLMMHLEERSSSLIHDNKGKSTRGPETSKNLKRKKYKKTNVFVDVESVSDTTEDVYGGK
KPRISKEFQKVAEQTQQHERMRIYEQALQQALLQALLKPHTRWHRENLRKHADLSFQGAN
VNSLGASGSNKKRRNKQFLDMEKTKAEAKKPKGNAEMRDLYAYRLIGVVSHLGKTPNSGH
YISDAYDFERQVWFTYNDLQVSSIQEALMQEARLCTGYIFFYMHNEIFEELLKREENSQS
CSTETGETLQEK
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggccactctaatggcacatggttttgtccaaatatggagcaagaggatggggatgtct
acgtccaaagaagcatacatcaaaacagtggaaagaaagaagatcaaactggtggtgcat
ttcaccaccggagaaaataaaacttttcagctaagtaataatattaaaaatgtggtcctt
agatcgtatggaaaaaagcaaaatcacctgcacttaactttccaaaacaatagcttcttg
tttattgaaaaattatcttccagagatgctaaacagttgaagatgttcctggatagagtc
catcaaaataatattcagccatctgtgagacctgtgaaggatggaggtatctttgccagc
attacaacaccgaaggtaatcaataaaaactcattccacaaagcgcgtaagaagccaagt
agtggatcttttcagacaggagaaggaagtggaacatctgaccagaagatgccttcgttt
gcattgaagtcatcaaaacctagttgcaaagatttactagagaatggatatgggaagagg
aaaaggatgctatcatctggttcagagatgaatgggaagaacccaaaaaagagtaactct
gtaagaaagaagaaatcccagacaaatcccttgatgcatgtaagccacagtgaaaagaaa
aaattgaggttaagagtgttaaaaaaggataagaaattagagtttgagcccttaatcaag
accgtttctcctgaaaagcctcccctggatggcaagggttttcttcagatgttgtctgag
aaaatgtatttggcatttcttttggcaccaaagtataatgcagattatccagagtgggac
aaactcaagatgacctttgatttctacccagaaaaattatggcaaggcctccccaatttg
ggaaacacctgttatatgaatgcagttttacagtccttattttcgattccatcatttgct
gatgatttactcagtcaggatttcccatggggtaaaattccccttgatgctctgaggatg
tgcttgacacagctgtttgttttgaaaaatatttataacataaaaatcaagaagaggtta
cttgtgaatattaaaaaagccatttcaacagttgcagagatcttctctggcaacatacaa
aatgatgctcatgagtttttaggccactgtttggatcagatgaaagagaacatggggaaa
ttaaacacaatttggaaaatgaaaattgaatccgaggaggacaattcagctcaacaggtc
tttgctggcagtgctgccaccagagtgctcatttgtcccgtcatcactaattttgagttt
gagctgctgcgctctattatttgtcaagcctgtggtcaggttgttcgcaaggcagaagtg
agtaattatctctccatcaaccttccccagggaatgcaagctctgcctttgtctattcaa
tctgcttttgatctcttctttggagcagaagaacttgagtataaatgtgagaaatgtcaa
cacaggagttctgttgcagtgcacaaattcagtaggctccccagggttctcattgttcat
ctgaaacgttatatctttaaccagttttggtcactaaggaaggatgaccaggaagttgtt
atttccaagtatttaaagttatcatctcattgcaatgaaagtaccaaaccacctcttcct
gtgagcaagaatgcacataatagggacttccacatcctcaaagtctttcagaagatgagt
gctgaaaacctctgtctattagcaccttccacaaagttgacctcggcatctagtcttttc
ccggttccacacatggggccagacaaagagtatgaaccacaaaaatgccagattctctat
aaaaggtcacacaatgaacagcagaaaaaagacctggaaaaatgttccagacggaatatg
acaaagtccaaattggtgaacgtaggagatggagcagtcattgaaaaagagctattagcc
cctagcttaatgatgcatctggaagaaaggtcctcttctctgatccatgacaacaaaggt
aaatccaccaggggtccagaaacgtctaaaaatctaaagcgaaagaaatacaagaaaact
aatgtgtttgtagatgttgagagtgtctctgataccactgaagatgtttatggtggtaaa
aaacccagaatttcaaaagaattccagaaagtggctgaacagacccagcagcatgaaagg
atgaggatctacgaacaagcccttcagcaggcactgcttcaagcccttttgaagccacac
acccggtggcacagggagaacctcaggaagcatgcagacttaagtttccagggggccaat
gtgaattccctcggtgcatcgggttccaataaaaaacgtagaaacaaacaatttttagat
atggagaagacaaaagctgaagccaagaaaccaaaaggaaatgctgagatgagagatctc
tatgcctatcggctcattggtgttgtcagccatcttgggaagaccccaaattcaggccat
tatatcagcgatgcctatgactttgagaggcaagtgtggttcacgtacaacgatctccag
gtatcaagtatccaagaagctctgatgcaggaggctaggctttgcaccgggtacatcttc
ttttacatgcacaatgagatcttcgaagagctgttgaaaagggaagagaactcccagtct
tgtagcacagagacaggggagacccttcaggagaaataa

DBGET integrated database retrieval system