KEGG   Ailuropoda melanoleuca (giant panda): 100478150Help
Entry
100478150         CDS       T01329                                 

Definition
cytochrome c, testis-specific-like
Orthology
K08738  
cytochrome c
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100478150
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100478150
   04115 p53 signaling pathway
    100478150
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100478150
   05210 Colorectal cancer
    100478150
   05222 Small cell lung cancer
    100478150
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100478150
   05012 Parkinson's disease
    100478150
   05014 Amyotrophic lateral sclerosis (ALS)
    100478150
   05016 Huntington's disease
    100478150
  Cardiovascular diseases
   05416 Viral myocarditis
    100478150
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100478150
  Infectious diseases
   05134 Legionellosis
    100478150
   05152 Tuberculosis
    100478150
   05164 Influenza A
    100478150
   05161 Hepatitis B
    100478150
   05168 Herpes simplex infection
    100478150
   05145 Toxoplasmosis
    100478150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 108 aa AA seqDB search
MGDVEAGKKIFIKKCAQCHTVEKDGKHKTGPNIWGLFGXKTGQAPGFSFSDANKNKGISS
SLWHRCYLMEYLENPKKYIPGTKMVFAGLKKKSEREDLIRYLKWATSS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgttgaagcaggcaagaagatctttattaaaaaatgtgctcagtgccacaca
gtggaaaaagatggaaaacacaagactggtccaaatatctggggcctttttggatgaaaa
acaggacaagcgccaggattttctttttctgatgctaacaaaaacaaaggaattagcagt
tctctgtggcataggtgttatctgatggaatatttggagaacccaaagaaatatatccct
ggaactaaaatggtctttgctggtcttaaaaagaaaagtgagagagaagatcttattcga
tatttgaaatgggcaacatcttcatga

DBGET integrated database retrieval system