KEGG   Ailuropoda melanoleuca (giant panda): 100478171Help
Entry
100478171         CDS       T01329                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100478171
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100478171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 277 aa AA seqDB search
MGGSDVAVPQAYPLGPLHEPASALMELQPRPRSSAEGFLEEELRLNAELSQLQFSEPVGI
IYNPVEYAWEPHRSYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGIGGP
VLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFRHCFVHNLCPLLFLTPS
GRNLTPAELPARQREQLLGACDGALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQ
VEGLLHPSPRSPQANRGWEAAAKERLNELGLLPLLTK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcagtgacgtggcagtgccccaggcttatccactggggcccctccatgagcct
gctagtgccctgatggagctgcagcctcgccctcgaagctcggctgagggcttcctggag
gaggagctgcggctcaatgcagaactgagccaactgcagttctcagagcctgtgggcatc
atctacaatcccgtggagtatgcctgggagccacaccgcagctatgtgacccgctactgc
cagggccccaaggaagtgctcttcctgggcatgaaccccggaccctttggcatggcccag
actggggtgccctttggggaagtgagtgtagtccgggactggttgggcattgggggacct
gtgttgaccccgccccaagagcacccgaagcgaccagtgctgggattggagtgccctcag
tcagaggtgagcggtgcccggttctggggctttttccggaacctctgtggacagcctgag
gtctttttccgtcactgttttgtccacaatctgtgtcctttgctcttcttgactcccagt
ggccgcaacctcactcccgctgagttgcctgccaggcagcgagaacagcttctcggggcc
tgtgatggggccctctgcaggcaggtgcagctgctgggggtgcggctggtggtgggagtg
gggcggctggcggagcagcgggcacggcgggctctggcaggcctgatgcctgaggtccag
gtggaggggctcctgcacccctcaccgcggagcccacaggccaacaggggctgggaggca
gcggccaaggagagactgaacgagctggggctgctgccactactaacaaaatga

DBGET integrated database retrieval system