KEGG   Ailuropoda melanoleuca (giant panda): 100478186Help
Entry
100478186         CDS       T01329                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100478186
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100478186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWLLSCCAFLGTTFGCGVPAIHPVLSGLSRIINGEDAVPGSWPWQVSLQDSTSFHFC
GGSLISEDXVVTATHCGVRTTHRVVARESDQGSDAEDIQVLKIAKVFKNPKFNTFTINND
XTLLKLATPGWFSQTVSAMCLPNENDDFPAGTLCATTGWGLTKHTNANTPDRLQQAALPL
LSNAKCKKFWGNKITNLMVCAGASGVSSCMGDSGGPLVCQKDRAWTLVSIVSWGSGTCST
SSPGVYARVTELIPWVRQILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctctggctcctctcctgctgcgccttcctgggcacaaccttcggctgcggg
gttcccgccatccatcccgtgctgagtggcctgtccaggatcatcaatggggaggatgct
gtcccgggctcctggccctggcaggtgtccctgcaggacagcactagcttccacttctgc
gggggctccctgatcagtgaggactaggtggtcactgccacccactgtggggtcagaacc
acccaccgggttgtggccagggagtctgaccagggctcagatgctgaggacatccaggtg
ctgaagattgccaaggttttcaagaaccccaagttcaacacattcaccatcaacaatgac
nncacactgctgaagctggccacgcccggctggttctcccagactgtgtccgccatgtgc
ctgcccaatgagaatgacgacttccctgccgggaccctgtgcgccaccaccggctggggc
ctgaccaaacacaccaatgccaacacccccgacaggctgcagcaggccgccctgcctctc
ctgtccaatgccaagtgcaagaagttctggggcaacaagatcaccaatctcatggtctgc
gccggggccagtggcgtgtcctcctgcatgggtgactctggtggccccctggtctgccag
aaggacagggcctggaccctggtgagcatcgtgtcctggggcagcggcacctgctccacg
tccagtcctggtgtgtacgcccgagtcaccgagctcatcccctgggtacggcagatcctg
gaagccaactga

DBGET integrated database retrieval system