KEGG   Ailuropoda melanoleuca (giant panda): 100478226Help
Entry
100478226         CDS       T01329                                 

Definition
ubiquitin carboxyl-terminal hydrolase 19-like
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1222 aa AA seqDB search
MSGGASATGPRRGPPGLEEATSKKKQKDRANQESKDGDPRRGSASSREEQAKEELLLDWR
QSADEVIVKLRVGAGPLRLEEVDAAFTDTDCVVRLPGGRQWGGVFYAEIESSCTKVQARK
GGLLQLALPKKVPLLTWPSLLAEAEEQLRVPPLNPQTCLLGSEENLALLAGEKTVSARSD
PVSPAMARSRDPEKGDRSKEEMAVAADAITLVAEPESMVNLAFVKNDSYEKGPDSVVVHV
YVKEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTF
CFTASRIDICLRKRQSQRWGGLEAPAPRGAVGGAKVAVPTGPTPLDSTPPGGTPHPLTGQ
EEARAVEKEKPKARSEDTGLDGVAARTPMEHVTPKPEPHLASPKPTCMVPPMPHSPVSGD
SVEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNP
LGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDG
LHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVC
AKVSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSISKENSSASEVLESLSQ
SVHVKSENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLPPELAKERVVVLEVQQ
RPQVPSVPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIG
YPFLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQGPGCTTLLSTSSLE
AGDSERDLIQPPELQLVTPVAEGDAGVPRAWAAPDRGPVPSTSGVSSEVLAGGPVEVGSL
PASERVSRPEAAVPGYQHPSEAMNAHTPQFFIYKIDASNREQRLEDKGDTPLELGEDCSL
ALVWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAW
YCPQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCI
GQKEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDES
QVVTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAEAAASQGLGPGQAPEVAPTRTA
PERFAPSVDRPAPTYSNMEEVD
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggggccagcgccaccggcccaaggagaggtcccccaggattggaggaggcc
accagtaagaagaagcagaaggatcgagcaaaccaggagagcaaggatggagatcctaga
agagggtcagcgtcctctcgggaggagcaggccaaagaggagttgttgcttgattggagg
cagagtgcagatgaggtgattgtcaagctgcgtgtgggagcaggtcccctgcgcctagag
gaagtggatgctgctttcacggacacagactgcgtggtgcggcttccaggtggtcggcag
tggggtggtgttttctatgccgagatagaaagttcttgcaccaaagtacaagcccgtaaa
ggtggcctcctgcagctggcactgcccaagaaggtgcctctgctcacgtggccctctctt
ctggctgaagctgaggaacagctccgggtaccaccgctgaacccccagacctgcctcttg
ggctcagaggagaatctagcactcttggcaggagagaagaccgtgtctgccaggagtgat
ccagtctccccagccatggcccggagcagagaccctgagaaaggtgaccgttccaaagaa
gagatggcagtggcagcagatgctataaccttggtggctgagccggagtccatggtgaac
ctggcatttgtcaagaatgactcgtatgagaaggggccagattcagtggtggtgcacgtg
tacgtgaaagaaatccgcagggacacttctcgagtgcttttccgcgagcaagacttcaca
cttatcttccagaccagggatggaaacttcttgagactgcaccctggctgtgggccccat
accatcttccgttggcaggtgaagctcaggaacctgattgagcccgagcagtgcaccttc
tgcttcacggcctctcgaattgacatctgcctccgtaagcggcaaagtcagcgctggggg
ggcctggaggccccagctccacgaggtgcagtgggtggtgcaaaggttgccgtgccgaca
ggtccaacccctctggattcaaccccaccgggaggtaccccccacccactcacaggccag
gaagaagctcgggctgtggagaaggaaaaacccaaggctcgatctgaggacacggggctg
gatggtgtggcagcccgcactcccatggagcatgtaaccccaaagccagagccacatctg
gcctcacccaagcccacatgtatggtgcctccaatgccccacagccctgtgagtggagac
agtgtggaggaagaggaggaggaagagaagaaggtgtgtctgccaggcttcactggcctt
gtcaatcttggcaacacctgcttcatgaacagtgtcattcagtctctgtctaacactcgg
gagctccgggacttcttccatgaccgctcctttgaggccgagatcaactacaacaaccca
ctggggactggtgggcgtctggccattggctttgctgtgctgcttcgggcgctgtggaag
ggcacccaccatgccttccagccttccaagttgaaggccattgtggcgagcaaggccagc
cagttcacaggctatgcacagcatgatgcccaggagttcatggctttcttgctggatggg
ctgcatgaagacctgaatcgcattcagaacaagccctacacagagaccgtcgactcggat
gggcggccggatgaggtggtggctgaagaagcatggcagcggcataagatgaggaatgac
tctttcatcgtagacctatttcagggccagtataagtcgaagctggtgtgccccgtgtgt
gccaaggtctccatcactttcgacccattcctctacctgccggtgcccttgccgcagaag
cagaaggttctccccgtcttctattttgcccgggagccccacagcaagcccatcaagttt
ctggtgagcatcagcaaggagaattccagcgcgagtgaagtgttggagtccctctctcag
agtgtgcacgtgaagtctgagaacctccgtctggctgaggtgattaaaaatcgtttccac
cgtgtgttcctgccctcccactcattggacactgtgtccccatccgacacgctcctctgc
tttgagctgctacccccagagttggctaaggagcgggtggtggtgctagaggtgcaacag
cgcccccaggtgcccagcgtccccatctccaagtgtgcagcctgccagcggaagcagcag
tcagaggatgagaagctgaagcgctgtacccggtgctaccgcgtgggctactgcaaccag
ctctgccagaaaacccactggcctgaccacaagggtctctgccgccctgagaacattggc
tacccatttctggtcagtgtacctgcctcacgtctcacttacgctcgtctcgctcagctg
ctagagggctatgcccggtactctgtgagtgtattccagccacccttccagcctggccgc
atggccttggagtcccagggccccggctgtactacgttgctctccactagttccctggag
gctggggacagtgagcgggacctgattcagccgcctgagctccagttggtgacccccgtg
gctgagggagacgcaggggtcccacgggcatgggcggcccctgaccggggccctgtgccc
agcaccagtggcgtttcttctgaggtgctggccggtgggcctgttgaagttggttccttg
cctgctagtgagagggtgtctcggcctgaagctgctgtgcccggatatcagcacccaagt
gaagccatgaatgcccacacaccccagttcttcatctataaaattgacgcatctaaccga
gaacagcggctagaggacaaaggagacacccccctggagctgggtgaggactgcagcctg
gcactagtctggcggaacaacgagcgcctgcaggagttcgtgttggtagcgtccaaggag
ctggagtgtgctgaggatccaggctctgctggggaggctgcccgcgctggccacttcact
ctggaccagtgcctgaacctcttcacccggcctgaggtgctggcacccgaggaggcttgg
tactgcccacagtgtaaacaacatcgagaggcttccaagcagctactgctgtggcgcctt
cctaatgtactcatcgtgcagctcaagcgcttctcctttcggagtttcatctggcgtgac
aagatcaatgacttggtggagttccctgttcggaacctggacctgagcaagttctgcatc
ggtcagaaggaggaacagctgcctagctacgacctgtacgccgtcatcaaccactacgga
ggcatgatcggcggccactacaccgcctgtgcgcgcctgcccaatgaccgaagcagccag
cgcagcgacgtgggctggcgcctgtttgacgacagcacggtgacaacagtagacgagagc
caggtcgtgacgcgttatgcctatgtactcttctaccgccggcggaactctcctgtggag
aggccccccagggcaggtcactcagagcaccacccagacctaggccctgcagccgaggct
gctgccagccagggactaggccctggccaggcccccgaggtggcccccacgcggacagcc
cctgaacgcttcgccccctctgtggaccgcccagcccccacctacagcaacatggaggag
gtcgattag

DBGET integrated database retrieval system