KEGG   Ailuropoda melanoleuca (giant panda): 100478257Help
Entry
100478257         CDS       T01329                                 

Definition
calcineurin B homologous protein 2-like
Orthology
K17611  
calcineurin B homologous protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MEDLTGDPPFFQLVSLQGGYELELPPAAFGPGATGAAGATAPGXXXXXXXGGRGNPGLPP
GVQVRGESGCQVEPGSQVSSSPAGRRVERVSQASLLRLYHRFRALDRNKKGYLSRMDLQQ
IGALAVNPLGERIIDSFFPDGNLRVDFPGFVRVLAHFRPVDDEDPSMRDPKEPEPLNSRM
NKLRFAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLESIADRTVQEADEDGDGAVS
FLEFAKSLEKMDIEQKMSIRILK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttgactggagacccaccgttcttccagcttgtctctcttcagggtggctat
gaacttgaactcccgcccgcggccttcggccctggggccactggggccgctggggcgacc
gcgcccgggnnnnnnnnnnnnnnnnnnnnnggcgggcgcgggaatccggggctccctccc
ggcgtgcaggtccggggcgagtccggctgccaggtggagccgggcagccaggtgtcctcg
agcccggcagggcggcgggttgagagggtctcgcaggccagtctgctccgcctctaccac
cggtttcgggccctggacaggaacaagaagggctacctgagccgcatggatctgcagcag
attggggcgctggccgtgaaccccctgggagaacgcattatagacagcttcttccctgat
gggaatctgcgagtggatttcccaggctttgtcagagtcctggctcattttcgacccgtc
gatgatgaggacccaagcatgcgagaccccaaggaacctgaacccctcaacagcagaatg
aacaaacttcgctttgcatttcagctttatgacctggatcgagatggaaagatctccagg
catgagatgctacaggtcctccggctgatggttggggtgcaggtgacagaagagcagttg
gagagcattgcggaccgcacagtgcaggaagcagatgaagatggggatggggccgtgtcc
ttcctggagttcgccaagtccttagagaaaatggacatcgagcagaaaatgagcatccgg
atcctgaagtga

DBGET integrated database retrieval system