KEGG   Ailuropoda melanoleuca (giant panda): 100478257Help
Entry
100478257         CDS       T01329                                 

Gene name
CHP2
Definition
(RefSeq) calcineurin-like EF-hand protein 2
  KO
K17611  
calcineurin B homologous protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100478257 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 274 aa AA seqDB search
MKRPVVRAAPLTPPPWALFSVRLGRGGLALVARFPRGSASSLRLQPQQRGPQVPGGRPLQ
QAPVPPTAARGRPGRGSPREGSAARPQRPRLCYPSAFRPVVSQASLLRLYHRFRALDRNK
KGYLSRMDLQQIGALAVNPLGERIIDSFFPDGNLRVDFPGFVRVLAHFRPVDDEDPSMRD
PKEPEPLNSRMNKLRFAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLESIADRTVQ
EADEDGDGAVSFLEFAKSLEKMDIEQKMSIRILK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccccgttgttcgcgccgcccctctgaccccgccaccctgggcattgttctct
gttcgcctgggtcgcggggggctggccctggtggctcgattcccccgcgggagcgcgtcg
tcactccgcctgcagccccaacagcgcggaccccaggtccccggcgggcgtcccctccag
caagctcctgtcccccccaccgcggcccggggtcgcccagggagggggtcgcccagggag
ggttccgccgcgcgtccccagcgcccgcggctgtgttacccttccgccttccgtcccgta
gtctcgcaggccagtctgctccgcctctaccaccggtttcgggccctggacaggaacaag
aagggctacctgagccgcatggatctgcagcagattggggcgctggccgtgaaccccctg
ggagaacgcattatagacagcttcttccctgatgggaatctgcgagtggatttcccaggc
tttgtcagagtcctggctcattttcgacccgtcgatgatgaggacccaagcatgcgagac
cccaaggaacctgaacccctcaacagcagaatgaacaaacttcgctttgcatttcagctt
tatgacctggatcgagatggaaagatctccaggcatgagatgctacaggtcctccggctg
atggttggggtgcaggtgacagaagagcagttggagagcattgcggaccgcacagtgcag
gaagcagatgaagatggggatggggccgtgtccttcctggagttcgccaagtccttagag
aaaatggacatcgagcagaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system