KEGG   Ailuropoda melanoleuca (giant panda): 100478269Help
Entry
100478269         CDS       T01329                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aml00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 230 aa AA seqDB search
MLSQEARVSRSTRIAPEILQLCRVIFLHGLGDTGHGWAEAFAGIRSSYIKYICPHAPIMP
VTLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENVKALIEQEVKNGIPSNRIVLGGFSQ
GGALSLYTALTTEQKLAGVTALSCWLPLRASFPQGPISGVNRDISILQCHGDCDPLVPLM
FASLTAEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDIKQFIDKLLPPVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgctatcgcaggaggcgcgagtgtccaggagtacccggatagcgccggaaattttgcaa
ctttgtcgtgtgattttccttcatggattgggagatacagggcatggatgggcagaagcc
tttgcaggtatcagaagttcatatatcaaatacatctgcccacatgcaccaattatgcct
gtaacattgaatatgaacatggctatgccttcttggtttgatattattgggctttcacca
gattcacaggaggatgaacctggaattaaacaggcagcagaaaatgtaaaagctttgata
gagcaagaggtgaagaatggcattccttctaacagaattgttttgggaggattttctcag
ggaggagctttatctttatacactgctcttaccacagagcagaaactggccggtgtcact
gcactcagttgctggcttccactccgggcttcatttccacagggtcctatcagtggcgtt
aatagagatatttctattcttcagtgccatggagattgcgatcctttagttcccctaatg
tttgcttctcttactgccgaaaagctgaaaacattagtaaatccagccaatgtaaccttc
aaaacctatgaaggcatgatgcacagttcatgtcaacaggaaatgatggatatcaagcag
ttcattgataagcttctacctccagttgattga

DBGET integrated database retrieval system