KEGG   Ailuropoda melanoleuca (giant panda): 100478363Help
Entry
100478363         CDS       T01329                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100478363
Peptidases [BR:aml01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100478363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 381 aa AA seqDB search
MRRLVVLLAVLALSQGSGISRVPLHKGKSLRKALKEHGLLEDFLKTHPYSISKKYSNLEK
VASEPLTNYLDCQYFGKISIGTPPQEFTVVFDTGSSDLWVPSVYCKSYACQSHHRFDPAK
SSTFQNLNKPLSIQYGTGSMQGFLGLDTVTVSTIVDSHQTVGLSTQEPGNVFTYSEFDGI
LGLAYPSLASEYSVPVFDNMMQTHLVARDLFSVYLARNGQGSMLTLGAIDPSYYTGSLHW
VPVTVREYWQFTVDRVTVNGVVVACDGGCQAILDTGTSMLVGPSSDILNIQTAIGAKEDQ
YGVFDINCGSLSSMPDVVFEIHGRKYPLPPSAYTSTDTGFCSSGFQGEGDSQLWILGDVF
IREYYSVFDRVNNRLGLAKAI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtctcgtggtgctcctcgccgtcctcgccctctcccagggcagtgggatctcc
agggtccctctgcacaaaggcaagtcgctgagaaaggccctgaaggagcatgggctcctg
gaggactttctgaagacacacccgtattccatcagcaagaagtactccaacctggagaag
gtggccagcgagcccttgaccaactacctggattgtcagtactttggaaagatctccatc
gggaccccaccccaggaattcaccgtggtgttcgacaccggctcctcagacctctgggtg
ccctctgtctactgcaagagttatgcctgccaaagccatcaccgcttcgacccggccaag
tcctccaccttccagaacctgaacaagcctctctccatccagtacggcacgggcagcatg
cagggattcctgggccttgataccgtcactgtgtccaccatcgtggactcccaccagacc
gtgggcctgagcacccaggagcctggcaacgtctttacctactctgagttcgacgggatc
ctggggctggcctacccctccctggcctccgagtactcggtgcccgtgttcgacaacatg
atgcagacgcatctggtggcccgagacctgttctctgtgtatttggccaggaacggccag
gggagcatgctcacactgggagccattgacccatcctactacacaggctccctgcactgg
gttcctgtgaccgtgcgggagtactggcagttcaccgtggacagggttactgtcaatggc
gtggtggtggcctgtgatggtggctgtcaggccatcctggacacaggcacctccatgctg
gttgggcccagcagcgacatcctcaacatccagacagccattggagccaaagaggaccag
tatggcgtgttcgacatcaactgcgggagcctgagtagtatgcctgacgtggtctttgag
atccatggccggaagtacccactgcccccctctgcctacaccagcacggatacgggcttc
tgctccagtggcttccagggggaaggggattcccagctgtggatcctgggggatgtcttc
atccgcgagtattacagcgtctttgacagggtcaacaaccgcttggggctggccaaggcc
atctga

DBGET integrated database retrieval system