KEGG   Ailuropoda melanoleuca (giant panda): 100478591Help
Entry
100478591         CDS       T01329                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100478591 (HDAC4)
  Substance dependence
   05034 Alcoholism
    100478591 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100478591 (HDAC4)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100478591 (HDAC4)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100478591 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 997 aa AA seqDB search
MDLRLDHQFALPVAEPTLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQL
HEHIKQQQELLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVAS
TEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHP
VLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVT
DSACSSAPGSAPSSPNNSSGNVSTENGITPAVASIPAETSLAHRLVTREGSVAPLPLYTS
PSLPNITLGLPATGPSAGAAGQQEAERLALPALQQRISLFPGTHLTPYLSTAPLERDGGA
AHNPLLQHMVLLEQPPAQTPLVTGLGALPLHAQPLVGADRVSPSMHKLRQHRPLGRTQSA
PLPQNAPALQHLVIQQQHQQFLEKHKQHFQQQLHMNKIIPKQNEPARQPESHPEETEEEL
REHQALLEEPYLDRLGGGGGGGGKEAHALAGVQVKQEPIESDDEEVEPPRDVEAGQRQPT
EQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQ
EPPTKPRFTTGLVYDTLMLKHQCACGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGR
KATLEELQTVHSEAHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNE
VHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKL
LQQRLDVSRTLIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGP
GVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLG
GYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKV
LQQRPNANAVRSMEKVIEIHSPGAPCRASAPRWGTLW
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggacctccgcctggaccaccagtttgcgctgcccgtggcggagcccaccctccgggag
cagcagctgcagcaggagctgctggccctcaagcagaagcagcagctccagaggcagatt
ctcatcgccgagttccaaaggcagcacgagcagctctcccggcagcacgaggcccagctg
cacgagcacataaaacaacagcaggagcttctggccatgaagcaccagcaggagctgctg
gaacaccagcggaagctcgagaggcaccgccaggagcaggagctggagaagcagcaccgg
gagcagaagctgcagcagctgaagaacaaggagaaaggcaaggagagtgcggtggccagc
acagaagtgaagatgaagttgcaagagtttgtcctcaataagaagaaggcgctggcccac
cggaacctcaaccactgcatttccagcgaccctcgctactggtacgggaagacacagcac
agttcccttgaccagagctccccgccccagagcggggtgtcggcctcctacaaccatccg
gtcctgggaatgtatgacagcaaggatgacttcccgctcagaaaaacagcctctgaaccc
aatttgaaattacggtccaggctaaagcagaaagtggctgaacgacggagcagccccctg
ctacgtaggaaagatgggccagtggttacggctctgaagaagcgtccgctggatgtcaca
gactcggcgtgcagcagcgcccccggctccgcgcccagctcccccaacaacagctccggg
aacgtcagcacggagaacgggatcacgcccgccgtcgccagcatcccagccgagaccagc
ttggcgcacagactcgtgactcgagaaggctccgtggccccactccccctctacacgtcg
ccatccttgcccaacatcacgctgggactgcctgccaccggcccgtctgctggggcggcc
ggccagcaggaagccgagagactcgctctcccagccctccagcagcggatctccctcttc
cccggcacccacctcactccctacctgagcacggcgcccctggagcgcgacggcggggct
gcgcacaacccgctcctgcagcacatggtcctgctggagcagccgcccgcgcagacgccc
ctcgtcacaggcctgggcgcgctgcccctgcacgcgcagcctctggtgggtgcggaccgc
gtgtccccatccatgcacaagctgcggcagcaccgcccgctggggcgcacccagtcggcc
ccgctgccccagaacgcgccagccctgcaacacctggtgatccagcagcagcaccagcag
ttcctggagaagcacaagcagcacttccagcagcagctgcacatgaacaagattatccct
aaacagaacgagccggcccggcagcccgagagccaccccgaggagaccgaggaggagctt
cgcgagcaccaggcccttctggaggagccctacctggaccggctgggggggggagggggg
gggggggggaaggaggcgcacgcgctggccggagtgcaggtgaagcaggagcccatcgag
agtgacgacgaggaggtggagcccccgcgggacgtagaggccggccagcgccagcccacg
gagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcggatccaccag
ctgaggaactaccaggcgtccatggaggccgccggcatccccgtgtcctttggcggccac
cggcctctgtcccgggcacagtcttccccggcgtctgccaccttccccatgtctgtgcag
gagcctcccaccaaaccgaggttcaccacaggcctcgtgtacgacacgctgatgctgaag
caccagtgcgcctgcgggagcagcagcagccaccccgagcacgccggccgcatccagagc
atctggtcgcggctgcaggagaccggcctccggggcaaatgcgagtgcatccgcggacgg
aaggccacgctggaagagctgcagacggtgcactcggaggcgcacgccctgctctacggc
acaaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcgctaacgtcc
gtgtttgtcaggctgccctgcggtggtgttggggtggacagcgacaccatatggaacgag
gtgcactcgtcaggggcggcccgcctggccgtgggctgcgtggtcgagctggtgttcaag
gtggccacgggggagctgaagaacggctttgctgtggtccgccctccaggacatcacgca
gaggagagcacacccatgggcttctgttactttaactccgtggccatcgcagccaagctt
ctccagcagcggctggacgtgagcaggaccctcatagtggactgggacgttcaccacgga
aacgggacccagcaggccttctacaatgacccgaatgtcctgtacatctcccttcaccgc
tatgatgacgggaacttcttcccgggcagtggggctccagacgaggtgggcacagggcca
ggtgtgggcttcaatgtcaacatggctttcaccggcggccttgacccccccatgggagac
gcggagtacttggcggccttcaggactgtggtcatgcccatcgcgaacgagtttgcccca
gacgtggtgctcgtgtcgtcaggcttcgacgctgtggagggccaccccacgcccctcggc
ggctacaacctctcggccaaatgttttggctacctgacgaagcagctgatgggcttggct
ggcggccggatcgttctggccctggaggggggccacgacctcacggccatctgcgacgcc
tcggaagcatgtgtttctgctttgctgggcaacgagcttgaccctctcccggagaaggtt
ttacagcagaggcccaatgctaacgcggtccggtccatggagaaagtcattgaaattcac
agccctggcgctccctgccgcgcctctgctccacggtggggcactctctggtag

DBGET integrated database retrieval system