KEGG   Ailuropoda melanoleuca (giant panda): 100478615Help
Entry
100478615         CDS       T01329                                 

Definition
early endosome antigen 1-like
Orthology
K12478  
early endosome antigen 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100478615
   04145 Phagosome
    100478615
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100478615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1402 aa AA seqDB search
TPGRVGSQGSDLDSSAAPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEVVHDAGN
DSSHGGEALALKRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKFQGLQQQESKPDGL
VADSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAA
EQKVTHLTEELNKETTIIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLEREKESE
KLKDECKKLQAEYANSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTHKNQNLSE
KLLKKELEFTQLEEKHNEECVSKKNIQANLHQKDLDCQQLQSRLSASETSLQRIQAELGE
KGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKDQHGLQLQSEVNQLHSKLLETERQ
LGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQ
HQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDL
YAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHL
RAAQDRVLSLETSVSELTGQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHL
DTAQNALQDKQQELNKITTQLDQVTTKLQDKQEHCSQLESHLKEYKEKHLSLEQKTEELE
GQIKKLEADTLEVKGSKDQALQDLQLQRQLNTDLELRATELSKQLEMEKEIVSSTKLDLQ
KKSEALENIKQMLTKQEEEKKILKQEIENLSQDAKMQHKELKKKKPTATTELQKVKVEKE
TLMTELSATKENLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMETTL
KEQSELKKSLEKEKQTSHQLKVELNSVQGQVVQVQNTLKQKEKEEQQLQGNINELKQLTE
QKKKQIEALQGEVKIAISQKTELESKLQQQSTQAAQELAAEKEKMLLLQNTYEKSQENLK
QLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKAALEQ
ESAKKEQQLKEQCKTLQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEIAKLSEELKS
HKQESIKEVTNLKDAKQLLIQQKLELQGKVDTLKATVEQEKRNQQMLKEQVKKEEDELKK
EFTEKEAKLQSEIKEKEIGMKRHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEK
QTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQE
LGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKN
ALTPSSKKPVRVCDACFNDLQG
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
actcctgggagagttggctctcaaggttctgatttagattcatcagcagctcctataaac
acagtggacgtcaataatgaaagctcttcagagggtttcatatgtccccagtgtatgaaa
tcccttggatctgctgacgaacttttcaaacactatgaggtagttcatgatgctggtaat
gactcaagtcatggaggagaggctcttgctctgaagcgagatgatataacactacttaga
caagaggtccaagatcttcaggcttcacttaaggaagaaaaatggtactcagaagaatta
aagaaagaattagaaaaatttcaagggctgcagcagcaagagtctaaacctgatggattg
gtggctgactcatcagcagaattacagtctttggaacaacaattagaagaagcccaaaca
gaaaattttaatattaagcaaatgaaagacttatttgaacagaaagcagcccaacttgcc
actgaaattgcagatataaagtcaaaatatgatgaagaaaggagtcttcgagaagctgct
gaacagaaagtgacacatctgacagaagaattaaacaaagaaacaactataattcaagat
ctgaagaccgaactgcttcagagacctggtatagaagatgttgctgtgctaaagaaagaa
ctggtgcaagttcaaacgctaatggacaacatgaccttggaacgggagaaagaatctgaa
aaactcaaagatgagtgcaaaaagttacaggcagaatatgctaactcagaggccacaata
agccagctaaggagtgagcttgccaaaggcccccaggaagttgctgtatatgtgcaggaa
ctacaaaaacttaaaagttcagttaatgaattaacacacaaaaatcagaacttgtctgaa
aagttgctgaagaaagaactggagtttactcagttagaggagaaacataatgaagaatgt
gtgagtaaaaagaatatacaagcaaaccttcatcaaaaagacttagattgtcaacagctt
cagtcaagattatctgcgtctgaaacctccctgcaaagaatacaggcagaactaggtgaa
aagggagaagctacacaaaagctcaaagaagaattatcagaagtggagaccaagtaccag
catcttaaggctgagtttaaacagctgcaacagcagagagaagaaaaagaccagcatggg
ttacaactccaaagtgaagttaatcaattacatagcaaacttctggagacagagcgccag
ctaggtgaagctcatggtaggctaaaggagcagagacaactttcaagtgaaaagttgatg
gataaagaacaacaagtggctgatctacagctcaaactttctcgtttagaagaacagttg
aaggaaaaagtaacaaattctacagaattgcagcatcaattagataaaacgaagcaacag
catcaagaacaacaagctcttcaacaaagcactacagcaaaacttcgagaagctcagaat
gatttagagcaagtactacgtcaaattggtgataaggaccaaaagatccagaaccttgaa
gccttgttacagaagagtaaagaaaatatttccttactagaaaaagaaagagaagatctt
tatgcaaaaattcaggctggtgaaggagagactgctgttcttaaccagttacaagaaaaa
aaccataccttacaggagcaagtaactcaactaacagagaagctgaagaatcagtcagaa
agccataaacaagcccaggagaatttgcatgaccaagtgcaagagcagaaggcacatctt
agagctgcacaagaccgtgttctttccttagaaaccagtgtcagtgaattgactggtcaa
ttaaatgagagcaaggagaaggtctcccagcttgacatacagattaaagccaaaactgaa
ttactgctatctgcagaagcagcaaaaactgctcagagagcagatcttcagaatcatttg
gacacagcccaaaatgcattacaagataaacagcaggagttaaataagatcactactcag
ttggatcaggttactacaaagttgcaggataagcaggaacattgcagtcagctggaaagt
catcttaaagaatataaagagaagcacctctctttagaacaaaaaactgaagaattagaa
ggtcaaatcaagaaactagaagccgatactcttgaagttaaaggaagcaaggatcaagct
ttgcaggatctacaactgcaaagacagctgaatacggatttagagcttagagccacagaa
ttgagtaaacaacttgaaatggagaaagaaatagtatccagtacgaagttggatctacag
aaaaaatctgaagctcttgaaaatattaagcaaatgcttaccaagcaagaggaagaaaaa
aaaatccttaaacaagaaattgaaaatttaagtcaagatgcaaagatgcagcacaaggaa
ttgaaaaaaaaaaaaccaaccgccacaacagaactgcaaaaagtgaaggtggagaaagaa
accctaatgacagagctttctgcaacaaaagagaatttatcaaaagtttctgattctttg
aagaactccaaaagcgaatttgaaaaggaaaatcagaaaggaaaagctgctatattagat
ttggaaaaaacttgcaaagaattgaagcatcagcttcaagtacagatggagaccacactt
aaggaacagagtgaactgaaaaagtcacttgaaaaagagaagcagacttctcatcagttg
aaggtggaactcaattcagtgcagggacaagttgtacaggtccagaatactttaaaacaa
aaggaaaaagaagaacagcaacttcaggggaacataaatgagctaaagcaattgactgaa
cagaagaaaaagcaaattgaagcactccaaggagaagttaaaatagctatttcacagaag
acagagcttgagagtaaactacagcagcagtcgacacaagcagcccaggaacttgcagca
gagaaagagaaaatgttactgttacaaaacacctatgaaaaaagtcaggaaaatctaaaa
cagcttcagtctgatttctatggaaaagaatctgagcttcttgccacaaggcaagatctt
aagtctgtagaagagaagctttctctagcacaggaggacttgatttcaaacagaaatcaa
attggaaaccaaaataaattgattcaagaactgaaaactgccaaggctgcgttggagcag
gagtcagcaaagaaagaacagcagttgaaggagcagtgtaaaacactacaggatattcaa
aaagaaaagtcactgaaagagaaagaactagtaaatgaaaaatctaaattggcagagata
gaggaaattaagtgtagacaggaaaaagaaattgctaaattgagtgaagagctcaagtcc
cacaagcaagaaagcataaaggaggtaacaaatctcaaggatgccaaacagcttttgatt
cagcagaaattagagcttcaagggaaagtagataccttgaaggcgaccgttgaacaggag
aagagaaaccagcaaatgctaaaagagcaggtgaaaaaggaagaagacgagctgaagaaa
gaatttactgagaaggaagctaaactgcaatctgaaataaaagaaaaagaaataggaatg
aagaggcatgaagaaaatgaagccaaacttaccatgcagattacagcattaaatgaaaac
ttaggcactgtaaagaaggagtggcagtccagtcaacggagagtcagtgagctcgagaaa
cagacggacgacttacggggtgaaattgcagtgttagaagccacagttcagaataatcag
gatgaaaggagagcactgctagaaagatgccttaaaggagaaggtgaaatagaaaagctt
caaaccaaagtcctagaattgcaaagaaagctggataataccactgcagcagtgcaggag
ctgggcagagaaaatcagtcccttcaaatcaaacacacacaagcgttaaataggaaatgg
gctgaagacaacgaagtacaaaactgtatggcctgtgggaaaggcttttcggtaacagtg
aggcggcatcactgcagacaatgtggaaatatcttctgtgctgaatgttcagccaaaaat
gccttaactccttcttccaagaagcctgttcgtgtctgtgatgcatgtttcaatgacttg
caaggataa

DBGET integrated database retrieval system