KEGG   Ailuropoda melanoleuca (giant panda): 100479331Help
Entry
100479331         CDS       T01329                                 

Definition
thymidine kinase, cytosolic-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100479331
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100479331
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100479331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 249 aa AA seqDB search
GGTGGSLSCELPGGAMSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQI
AQYKCLVIKYAKDTRYSSSFSTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDI
VEFSETMANAGKTVIVAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKR
LGSEKEVAPTYHSVCRLCYFKKASGLPAAPDGRENKENCPVLVRGMPGEAAGVRKLFAAH
QILQCSPAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ggtggcaccggagggtccctgagctgcgagcttcctggaggcgccatgagctgcatcaac
ctgcccaccgtgctgcccggctcccccagcaagacccgggggcagattcaggtgattcta
ggacccatgttctcaggaaaaagtactgagctgatgcgccgggtccgtcgcttccagatt
gcccagtacaagtgcttggtgatcaagtatgccaaagacactcggtacagcagcagcttc
tccacacatgaccggaacaccatggaggcactgccagcctgcctgctccgggacgtggct
caggaggccctgggcgtggctgtcataggcattgacgaagggcagtttttcccagacatc
gtggagttcagcgagactatggccaacgccgggaagaccgtgatcgtggccgcgctggac
gggaccttccagaggaaggcattcggaaccatcctgaacctggtgcccctggcggagagc
gtggtgaagctgacagccgtgtgcatggagtgcttccgggaggccgcctacaccaagcgg
ctaggctcggagaaagaggtagcccccacataccactccgtgtgccgcctctgctatttc
aagaaggcctcgggtctgcccgccgcgccggacggcagggagaacaaggagaactgcccg
gtgctggtgcggggaatgccgggagaggcggcgggcgtccggaagctgttcgccgcgcat
cagatcctgcagtgcagcccggccaactga

DBGET integrated database retrieval system