KEGG   Ailuropoda melanoleuca (giant panda): 100479331Help
Entry
100479331         CDS       T01329                                 

Definition
thymidine kinase, cytosolic-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aml00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:aml00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 249 aa AA seqDB search
GGTGGSLSCELPGGAMSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQI
AQYKCLVIKYAKDTRYSSSFSTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDI
VEFSETMANAGKTVIVAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKR
LGSEKEVAPTYHSVCRLCYFKKASGLPAAPDGRENKENCPVLVRGMPGEAAGVRKLFAAH
QILQCSPAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ggtggcaccggagggtccctgagctgcgagcttcctggaggcgccatgagctgcatcaac
ctgcccaccgtgctgcccggctcccccagcaagacccgggggcagattcaggtgattcta
ggacccatgttctcaggaaaaagtactgagctgatgcgccgggtccgtcgcttccagatt
gcccagtacaagtgcttggtgatcaagtatgccaaagacactcggtacagcagcagcttc
tccacacatgaccggaacaccatggaggcactgccagcctgcctgctccgggacgtggct
caggaggccctgggcgtggctgtcataggcattgacgaagggcagtttttcccagacatc
gtggagttcagcgagactatggccaacgccgggaagaccgtgatcgtggccgcgctggac
gggaccttccagaggaaggcattcggaaccatcctgaacctggtgcccctggcggagagc
gtggtgaagctgacagccgtgtgcatggagtgcttccgggaggccgcctacaccaagcgg
ctaggctcggagaaagaggtagcccccacataccactccgtgtgccgcctctgctatttc
aagaaggcctcgggtctgcccgccgcgccggacggcagggagaacaaggagaactgcccg
gtgctggtgcggggaatgccgggagaggcggcgggcgtccggaagctgttcgccgcgcat
cagatcctgcagtgcagcccggccaactga

DBGET integrated database retrieval system