KEGG   Ailuropoda melanoleuca (giant panda): 100479331Help
Entry
100479331         CDS       T01329                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00240  Pyrimidine metabolism
aml00983  Drug metabolism - other enzymes
aml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100479331 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100479331 (TK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100479331 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 zf-C3HC4 ATPase_2
Motif
Other DBs
NCBI-GeneID: 100479331
NCBI-ProteinID: XP_002918437
Ensembl: ENSAMEG00000013839
Position
Un
AA seq 234 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFSTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGSEKEVAPTYHSVC
RLCYFKKASGLPAAPDGRENKENCPVLVRGMPGEAAGVRKLFAAHQILQCSPAN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgcccaccgtgctgcccggctcccccagcaagacccgggggcag
attcaggtgattctaggacccatgttctcaggaaaaagtactgagctgatgcgccgggtc
cgtcgcttccagattgcccagtacaagtgcttggtgatcaagtatgccaaagacactcgg
tacagcagcagcttctccacacatgaccggaacaccatggaggcactgccagcctgcctg
ctccgggacgtggctcaggaggccctgggcgtggctgtcataggcattgacgaagggcag
tttttcccagacatcgtggagttcagcgagactatggccaacgccgggaagaccgtgatc
gtggccgcgctggacgggaccttccagaggaaggcattcggaaccatcctgaacctggtg
cccctggcggagagcgtggtgaagctgacagccgtgtgcatggagtgcttccgggaggcc
gcctacaccaagcggctaggctcggagaaagaggtagcccccacataccactccgtgtgc
cgcctctgctatttcaagaaggcctcgggtctgcccgccgcgccggacggcagggagaac
aaggagaactgcccggtgctggtgcggggaatgccgggagaggcggcgggcgtccggaag
ctgttcgccgcgcatcagatcctgcagtgcagcccggccaactga

DBGET integrated database retrieval system