KEGG   Ailuropoda melanoleuca (giant panda): 100479522Help
Entry
100479522         CDS       T01329                                 

Definition
alcohol dehydrogenase E chain-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100479522
  Lipid metabolism
   00071 Fatty acid degradation
    100479522
  Amino acid metabolism
   00350 Tyrosine metabolism
    100479522
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100479522
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100479522
   00982 Drug metabolism - cytochrome P450
    100479522
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100479522
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100479522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVASGICRSDEHVVNGTIVA
PLPLILGHEAAGIVESIGEGVTTVKPGDKVIPLFTPQCGKCNVCKHPQGNFCLKNDLSTP
RGSMQDGTTRFTCRGKPIHHFVSTSTFSQYTVVDEIAVAKIDPASPLEKVCLIGCGFSTG
YGSAVNIAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIGVDINKDKYAKAKEVGATE
CISPQDYKEPIQDVLKEMSGGGVDFSFEVIGRLDTMVAALSCCQESYGVSVIVGVPPNSQ
NLSMNPMLLLTGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHVLPFEKINEGF
DLLRSGKSIRTILTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtgatcaaatgcaaagcagctgtgctgtgggagctaaagaag
cccttttccattgaggaggtcgaggtcgcaccccctaaggcccatgaagtccgtattaag
atggtggcctcaggaatctgtcgctccgatgaacacgtggttaatggaacgatcgttgca
cctctccctctgatcttgggccatgaggcagccggcattgtggaaagcattggagaaggg
gtgactacagtaaaaccaggtgacaaagtcattccactctttactccccagtgtggaaaa
tgcaacgtttgcaagcatccgcaaggcaacttctgcttgaaaaatgatctgagcacacct
cgggggagcatgcaggatggtaccaccaggttcacctgcagaggaaagcccatccaccat
ttcgtcagcaccagcaccttctcccagtacacggtggtggatgagattgcagtggccaag
atagatccagcttccccactggagaaagtctgtctcatcggctgtggattttctactggt
tatgggtctgcagtcaacattgctaaggtcaccccgggctccacctgtgccgtgtttggc
cttggaggagttggcctgtctgtgatcataggctgtaaagcagcaggagcagccaggatc
attggggtggacatcaacaaagataaatatgcaaaggccaaagaggtgggtgccactgag
tgcatcagccctcaggactacaaggaacccatccaggatgtgctgaaggaaatgagtggt
ggcggtgtggatttttcatttgaagtcattgggcggcttgacaccatggtggctgccttg
tcctgctgtcaagagtcctatggtgtaagcgtcattgtaggagtacctcctaattctcaa
aatctctctatgaaccccatgttgctactgaccggacgtacttggaaaggagcaattttt
ggtggctttaagagtaaagattctgtccccaaacttgtggctgattttatggccaagaag
tttccactggatccattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcgctctggaaagagcatccgcaccatcctaacattctga

DBGET integrated database retrieval system