KEGG   Ailuropoda melanoleuca (giant panda): 100479580Help
Entry
100479580         CDS       T01329                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Cholinergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Regulation of lipolysis in adipocytes
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Carbohydrate digestion and absorption
Bacterial invasion of epithelial cells
Chagas disease (American trypanosomiasis)
Amoebiasis
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Fluid shear stress and atherosclerosis
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100479580 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100479580 (PIK3CD)
   04015 Rap1 signaling pathway
    100479580 (PIK3CD)
   04012 ErbB signaling pathway
    100479580 (PIK3CD)
   04370 VEGF signaling pathway
    100479580 (PIK3CD)
   04630 Jak-STAT signaling pathway
    100479580 (PIK3CD)
   04668 TNF signaling pathway
    100479580 (PIK3CD)
   04066 HIF-1 signaling pathway
    100479580 (PIK3CD)
   04068 FoxO signaling pathway
    100479580 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100479580 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100479580 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100479580 (PIK3CD)
   04024 cAMP signaling pathway
    100479580 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100479580 (PIK3CD)
   04152 AMPK signaling pathway
    100479580 (PIK3CD)
   04150 mTOR signaling pathway
    100479580 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100479580 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    100479580 (PIK3CD)
   04218 Cellular senescence
    100479580 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100479580 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100479580 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100479580 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100479580 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100479580 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100479580 (PIK3CD)
   04660 T cell receptor signaling pathway
    100479580 (PIK3CD)
   04662 B cell receptor signaling pathway
    100479580 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100479580 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100479580 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100479580 (PIK3CD)
   04062 Chemokine signaling pathway
    100479580 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    100479580 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    100479580 (PIK3CD)
   04915 Estrogen signaling pathway
    100479580 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100479580 (PIK3CD)
   04917 Prolactin signaling pathway
    100479580 (PIK3CD)
   04926 Relaxin signaling pathway
    100479580 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100479580 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100479580 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100479580 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    100479580 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100479580 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100479580 (PIK3CD)
  Development
   04360 Axon guidance
    100479580 (PIK3CD)
   04380 Osteoclast differentiation
    100479580 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    100479580 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100479580 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100479580 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100479580 (PIK3CD)
   05231 Choline metabolism in cancer
    100479580 (PIK3CD)
   05205 Proteoglycans in cancer
    100479580 (PIK3CD)
   05203 Viral carcinogenesis
    100479580 (PIK3CD)
   05210 Colorectal cancer
    100479580 (PIK3CD)
   05212 Pancreatic cancer
    100479580 (PIK3CD)
   05225 Hepatocellular carcinoma
    100479580 (PIK3CD)
   05226 Gastric cancer
    100479580 (PIK3CD)
   05214 Glioma
    100479580 (PIK3CD)
   05221 Acute myeloid leukemia
    100479580 (PIK3CD)
   05220 Chronic myeloid leukemia
    100479580 (PIK3CD)
   05218 Melanoma
    100479580 (PIK3CD)
   05211 Renal cell carcinoma
    100479580 (PIK3CD)
   05215 Prostate cancer
    100479580 (PIK3CD)
   05213 Endometrial cancer
    100479580 (PIK3CD)
   05224 Breast cancer
    100479580 (PIK3CD)
   05222 Small cell lung cancer
    100479580 (PIK3CD)
   05223 Non-small cell lung cancer
    100479580 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100479580 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100479580 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100479580 (PIK3CD)
   04931 Insulin resistance
    100479580 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100479580 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100479580 (PIK3CD)
   05166 HTLV-I infection
    100479580 (PIK3CD)
   05162 Measles
    100479580 (PIK3CD)
   05164 Influenza A
    100479580 (PIK3CD)
   05161 Hepatitis B
    100479580 (PIK3CD)
   05160 Hepatitis C
    100479580 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100479580 (PIK3CD)
   05169 Epstein-Barr virus infection
    100479580 (PIK3CD)
   05165 Human papillomavirus infection
    100479580 (PIK3CD)
   05146 Amoebiasis
    100479580 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    100479580 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100479580 (PIK3CD)
   01524 Platinum drug resistance
    100479580 (PIK3CD)
   01522 Endocrine resistance
    100479580 (PIK3CD)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100479580 (PIK3CD)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100479580 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 1029 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLHDPEVNAFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRQEYLYGGYPLCQFQYICGCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEVSWGPWARHEVQERFPEALARLLLVTKWNKHED
VAGAGSPQMLYLLGSWPELPVLSALELLDCSFPDRHVGSFAIKSLRKLTDDELFRYLLQL
VQVLKYESYLDCELAKFLLARALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGS
THHMKVLVKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHVCMRQETYLEALSNVQSPL
DPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKNGDDLRQDMLTLQMIQ
LMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDAL
LNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHF
LGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFL
HLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLA
HNVSKDNRQ
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gccgttgacttcctgttgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgggcccagtatgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgccagtgctgcgg
ctcgtggcccgagagggcgacagggtgaagaagctggtcaactctcagatcagcctcctc
atcggcaaaggcctccacgagttcgactccctgcatgacccagaagtgaatgccttccgc
accaagatgcgccagttctgtgaggaggcggccgcccggcggcagcagctgggctgggag
gcctggctacagtacagcttcccgctgcagctggagccctcggcgcggagctggggggcc
ggcaccctgagggtccccaaccgggccctcctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcgtgcgcg
ctgcggaagaaggccaccgtgttccggcagcccctggtggagcagcccgaggactacaca
ctgcaggtgaacgggaggcaggagtacctgtacggcggctacccgctctgccagttccag
tacatctgcggctgcctgcacagcggcctgaccccccacctgaccatggtgcactcgtcc
tccatcctcgccatgcgggacgagcagagcgaccctgccccccaagtccagaaaccgcgc
accaaaccaccccccattcccatgaagaagccttcctccttgtccctgtggtccctggag
cagcctttctgcgtggagctgattcagggcagcaaagtgaatgccgatgagcggatgaag
ctggtcgtgcaggcggggctgttccacggcaacgagacgctgtgcaagacagtgtccagc
tcggaggtgagcgtgtgctcagagcccgtatggaaacagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcttgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccgtccgtcccagacgagaaaggggagctgctgaaccccacggggacagtgagg
agtaaccccaacacggagagcgctgcggccctcgtcatctgcctccccgaggtggccccc
taccctgtgtactaccccaccctggacaagattctggagctggggcggcacggggagcac
gggcgcttcagcgaggaagaggtgagctgggggccgtgggcgcggcacgaggtccaggag
cgcttccccgaggcgctggcccgcctgctgctggtcaccaagtggaacaagcacgaggac
gtggctggtgctggctccccccagatgctctacctgctgggctcctggcccgagctgccc
gtcctgagcgccctggagctgctggactgcagcttccccgaccgccacgtgggctccttc
gccatcaagtctctgcggaagttgacggacgacgagctcttccggtacctgctgcagctg
gtgcaggtgctcaagtacgagtcctacctcgactgcgagctggccaagttcctgctggcg
cgggccctggccaaccgcaagatcggccacttcctcttctggcacctccgctccgagatg
cacgtgccgtccgtggctctgcgcttcggcctcatcatggaggcctactgccggggcagc
acccaccacatgaaggtgctcgtgaagcagggggaggcgctgagcaaactgaaggccctg
aatgacttcgtcaaagtgagctcccagaagaccaccaagccccagaccaaggagctgatg
cacgtgtgcatgcgtcaggagacctacctggaggccctctccaacgtgcagtccccgctg
gaccccagcaccctgctggctgaagtctgcgtggagcagtgcaccttcatggactccaag
atgaagcccttgtgggtcatgtacagcaacgaggaggcaggcagcgacggcagcgtgggc
atcatctttaagaacggggacgacctccgccaggacatgctgactctgcagatgatccag
ctcatggatgttctgtggaagcaggagggactggacctgaggatgaccccctacggctgc
ctctccacgggggaccgcactggcctcatcgaggtggtgcttcactcagacaccatcgcc
aacatccagttgaacaaaagcaacatggcggccacagctgccttcaacaaggatgccctg
ctcaactggctcaagtccaagaaccctggggaggccttggatcgagccatcgaggagttt
accctctcctgtgccggctactgtgtggccacttacgtgctgggcatcggagatcggcac
agcgacaacatcatgatccgcgagaacgggcagctcttccacattgatttcggccacttt
ctgggcaacttcaagaccaagtttggaatcaaccgtgagcgagtcccgttcatcctcacg
tatgactttgtgcacgtgatccagcaggggaaaacgaataacagtgagaaatttgaaagg
ttccggggttactgtgagcgagcctacactatcctgaggcgccacgggctgctctttctc
cacctcttcgccctgatgcgggctgccggcctgcctgagctcagctgctccaaagacatc
cagtatctcaaggactctctggcgttgggaaagacggaggaggaggctctaaagcacttc
cgagtgaagttcaacgaagccctccgggagagctggaaaaccaaagtgaactggctggcc
cacaatgtgtccaaagataacaggcaatag

DBGET integrated database retrieval system