KEGG   Ailuropoda melanoleuca (giant panda): 100479704Help
Entry
100479704         CDS       T01329                                 

Gene name
EIF3B
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100479704 (EIF3B)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100479704 (EIF3B)
Translation factors [BR:aml03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100479704 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 210 aa AA seqDB search
MFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGR
YVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDL
KKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKSERLELRGGVDT
DELDSNVEDWEEETIEFFVTEEIIPLGNQE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataagcagcaggccaataccatcttctggagcccccagggacagttcgtcgtg
ttggctggtctgaggagtatgaacggcgccttggctttcgttgacacctcggactgtacg
gtcatgaacattgcagagcactacatggcctccgacgtggagtgggaccccactgggcgc
tatgttgtcacctctgtgtcctggtggagccacaaggtggacaacgcgtactggctgtgg
actttccaaggtcgccttctgcagaagaacaacaaggaccgcttctgtcagctgctgtgg
agaccgcggcctcccacgctcctgagccaggatcagatcaagcaaattaaaaaggatctg
aagaaatactctaagatctttgagcagaaggatcgtctgagccaatccaaagcctcaaag
gaactggtggagagaagacgcaccatgatggaagatttccgaaaataccgaaaaatggcc
caagaactctacatggagcagaagagtgaacgtctggaattgcgaggaggtgtggacacc
gatgagctggacagcaatgtggaggactgggaggaggagaccatcgagttctttgtcacc
gaggagatcatccccttgggaaatcaggagtga

DBGET integrated database retrieval system