KEGG   Ailuropoda melanoleuca (giant panda): 100479774Help
Entry
100479774         CDS       T01329                                 

Gene name
DYRK1A
Definition
(RefSeq) dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100479774 (DYRK1A)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100479774 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 734 aa AA seqDB search
MAGQMPHSHQYSDRRQPNISDQQVSALSYSDPIQQPLTNQVMPDIVMLQRRMPQTFRDPA
TAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIV
KNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLEL
MNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQM
CTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRS
PEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLSIPPAHILDQAP
KARKFFEKLPDGTWNLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADY
LKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTS
STSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQQFPAPLGWS
GTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTR
PRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANT
LDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPTHYMTEGHLTMRQGADREESP
MTGVCVQQSSVASS
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggctggacagatgccccattcacatcagtacagtgaccgtcgccagccaaacataagt
gaccaacaggtttctgccttatcttattctgacccgattcagcaacctctaactaaccag
gtgatgcctgatattgtcatgttacagaggcggatgccccaaaccttccgtgatccagca
actgctcccctgagaaaactttctgttgacttgatcaaaacatataagcatattaatgag
gtttactatgcaaaaaagaagcgaagacaccaacagggccagggagacgattctagtcat
aagaaggagcggaaggtttataatgatggttatgatgatgataactatgattatattgta
aaaaacggagagaagtggatggatcgttacgaaattgactccttgattggcaaaggttcc
tttggacaggttgtaaaggcatatgatcgtgtggagcaagaatgggttgccattaaaata
ataaagaacaagaaggcttttctgaatcaagcccaaatagaagtgcgacttcttgagctc
atgaacaaacatgacactgaaatgaaatactacatagtgcatttgaaacgccactttatg
tttcgaaaccatctctgtttagtttttgaaatgctgtcgtacaacctctatgacttgttg
aggaacaccaattttcgaggtgtctctttgaacctaacacgaaagtttgcacagcagatg
tgcactgcactgcttttcctcgcgactccagaacttagtatcattcactgtgacctaaaa
cctgagaatatccttctttgtaaccccaaacgcagtgcaatcaagatcgttgactttggc
agttcctgtcaattggggcagaggatataccagtatattcagagtcgcttttatcggtct
ccagaggtgctactgggaatgccttacgaccttgctattgacatgtggtcccttgggtgt
attttggttgaaatgcacactggagaacctctgttcagtggagccaatgaggtagatcag
atgaataaaatagtggaagttctgagtattccacctgctcatattcttgaccaagcacca
aaagcaagaaagttctttgagaagttgccagatggcacttggaacttaaagaagaccaaa
gatggaaaacgggagtataaaccaccaggaacccgtaaacttcataatattctcggagta
gaaacaggaggacctggtgggcgtcgtgctggggaatcgggtcatactgtagctgactac
ttgaagttcaaagacctcattttaaggatgcttgattatgaccccaaaactcgaattcaa
ccttactatgccctgcagcacagttttttcaagaaaacagctgacgaaggcactaacaca
agtaatagtgtgtctaccagccccgcgatggagcagtcccagtcttcgggcaccacctcc
agtacgtcttcaagctcaggtggatcgtcggggacgagcaacagcgggagagccaggtca
gacccgacgcaccagcaccggcacagcggcgggcacttcacagctgcagtccaggccatg
gactgtgagacccacagtccccaggtgcgtcagcaatttcctgctccccttggttggtca
ggcactgaagctcctacacaggtcactgtggaaactcatcccgttcaagaaacaaccttt
catgtagcccctcagcagaatgcattgcatcatcaccatggaaacagttcccatcaccat
caccaccaccatcaccaccaccaccaccatggacaacaagccttgggtaaccggaccagg
ccaagggtctacaattctccaacgaatagctcctctacccaggattctatggaggttggc
catagtcaccactccatgacatccctgtcttcctcaactacttcctcctctacatcttcc
tcctcgactggtaatcaaggcaatcaggcctaccagaatcgcccagtggctgctaatacc
ttggactttggacagaatggagctatggacgttaatttaaccgtctactccaatccccgc
caagagactggcatagctggacatccaacataccaattttctgctaatacaggtcctaca
cattacatgactgaaggacatctgacaatgaggcaaggggctgatagagaagagtccccc
atgacaggagtttgtgtgcaacagagttctgtagctagctcgtga

DBGET integrated database retrieval system