KEGG   Ailuropoda melanoleuca (giant panda): 100479839Help
Entry
100479839         CDS       T01329                                 

Definition
retinoic acid receptor RXR-alpha-like
Orthology
K08524  
retinoid X receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:aml04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:aml03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:aml04919]
Organismal Systems; Digestive system; Bile secretion [PATH:aml04976]
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:aml05202]
Human Diseases; Cancers; Thyroid cancer [PATH:aml05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:aml05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:aml05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:aml04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:aml05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 516 aa AA seqDB search
MVVMVTVIVMTMTVVMMVVMMVTMIVVTVMVMMVAMTVVILMVMMMVGKQSFRKVGAEDF
STQVNSSSLNSPTGRGSMAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFS
VISSPMGPHSMSVPTTPTLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGN
MASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLICAREAQR
CECLRYQRGLTTAPTRTAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKT
ETYVDANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTE
LGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALR
SIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgatggtgactgtgatagtgatgacgatgacggtggtgatgatggtggtgatg
atggtgacgatgattgttgtgactgtgatggtgatgatggtggcgatgactgtagtgatt
ctgatggtgatgatgatggtggggaagcagtccttccggaaggtgggtgccgaagacttc
tccacccaggtgaactcctcgtccctcaactcccccacggggcgtggctccatggctgcc
ccctccctgcacccctctctggggcccggcatcggctcctcgctcggctccccgggacag
ctgcattcgcccatcagcaccctgagctcccccatcaacggcatgggcccacccttctcg
gtcatcagctcccccatgggcccccactccatgtcagtgcccaccacgcctaccctgggc
ttcggcaccggcagccctcagctcagctcacccatgaaccccgtcagcagcagcgaggac
atcaagcccccgctgggcctcaatggtgtcctcaaagtcccggcccacccctcagggaac
atggcgtccttcaccaagcacatctgtgccatctgtggggaccgctcctcaggcaagcac
tatggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtgcgcaaggac
ctgacctacacgtgccgggacaacaaggactgcctgatctgcgcacgggaggcacagagg
tgtgagtgcctcaggtaccagcgtgggctgaccaccgcccccacccgtacagctgtgcag
gaggaacggcagcggggcaaggacaggaacgagaacgaggtggagtccacgagcagtgcc
aacgaggacatgccggtggagaagattctggaggcagagctggctgtcgagcccaagacc
gagacgtacgtggacgcaaacatggggctgaacccaaactcgcccaacgaccccgtcacc
aacatctgccaggcagcggacaagcagctcttcacgctggtcgagtgggccaagcggatt
ccgcacttctcggagctgcccctggacgaccaggtcatcctactgagggcaggctggaat
gagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggacgggatcctcctg
gccaccgggctgcacgtccaccggaacagcgcccacagcgcgggggtgggcgccatcttt
gacagggtgttgacggagctcgtgtccaagatgcgggacatgcagatggacaagacggag
ctgggctgcctgcgtgccatcgtactcttcaaccccgactccaaggggctctcgaacccg
gccgaggtcgaggcgctgagggagaaggtctacgcgtccctggaggcgtactgcaaacac
aagtaccccgagcagccgggaaggttcgccaagctgcttctccgcctgccggccctgcgc
tccatcggcctcaagtgcctggaacacctctttttcttcaaactcatcggggacacgccc
atcgacaccttcctcatggagatgctggaagccccccaccaaatgacttag

DBGET integrated database retrieval system