KEGG   Ailuropoda melanoleuca (giant panda): 100479839Help
Entry
100479839         CDS       T01329                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor, alpha
  KO
K08524  
retinoid X receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100479839 (RXRA)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100479839 (RXRA)
   03320 PPAR signaling pathway
    100479839 (RXRA)
   04919 Thyroid hormone signaling pathway
    100479839 (RXRA)
  Digestive system
   04976 Bile secretion
    100479839 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100479839 (RXRA)
   05202 Transcriptional misregulation in cancers
    100479839 (RXRA)
   05216 Thyroid cancer
    100479839 (RXRA)
   05222 Small cell lung cancer
    100479839 (RXRA)
   05223 Non-small cell lung cancer
    100479839 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100479839 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    100479839 (RXRA)
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100479839 (RXRA)
Nuclear receptors [BR:aml03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100479839 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 459 aa AA seqDB search
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLICAVGLARPSLHACSPPSAALAGTL
AWGWHCLAPDGGLTTAPTRTAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVE
PKTETYVDANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRA
GWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMD
KTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLP
ALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccctccctgcacccctctctggggcccggcatcggctcctcgctcggctcc
ccgggacagctgcattcgcccatcagcaccctgagctcccccatcaacggcatgggccca
cccttctcggtcatcagctcccccatgggcccccactccatgtcagtgcccaccacgcct
accctgggcttcggcaccggcagccctcagctcagctcacccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctcaatggtgtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgtggggaccgctcctca
ggcaagcactatggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacgtgccgggacaacaaggactgcctgatctgcgcagtgggc
ctcgcccgaccctcactgcatgcctgctcgcctccctcggcggccttggcgggcacactg
gcttggggctggcactgcttggcccctgatggtgggctgaccaccgcccccacccgtaca
gctgtgcaggaggaacggcagcggggcaaggacaggaacgagaacgaggtggagtccacg
agcagtgccaacgaggacatgccggtggagaagattctggaggcagagctggctgtcgag
cccaagaccgagacgtacgtggacgcaaacatggggctgaacccaaactcgcccaacgac
cccgtcaccaacatctgccaggcagcggacaagcagctcttcacgctggtcgagtgggcc
aagcggattccgcacttctcggagctgcccctggacgaccaggtcatcctactgagggca
ggctggaatgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggacggg
atcctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgcgggggtgggc
gccatctttgacagggtgttgacggagctcgtgtccaagatgcgggacatgcagatggac
aagacggagctgggctgcctgcgtgccatcgtactcttcaaccccgactccaaggggctc
tcgaacccggccgaggtcgaggcgctgagggagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtaccccgagcagccgggaaggttcgccaagctgcttctccgcctgccg
gccctgcgctccatcggcctcaagtgcctggaacacctctttttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccccaccaaatgacttag

DBGET integrated database retrieval system