KEGG   Ailuropoda melanoleuca (giant panda): 100479895Help
Entry
100479895         CDS       T01329                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100479895 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100479895 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100479895 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    100479895 (COMP)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100479895 (COMP)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100479895 (COMP)
  Exosomal proteins of colorectal cancer cells
   100479895 (COMP)
  Exosomal proteins of bladder cancer cells
   100479895 (COMP)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100479895 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 770 aa AA seqDB search
MGSREQAAVQLPVAMVPATACVLLLTLAVLGASGQGQISLGADLGPQMLRELQETNAALQ
DVRELLRQQVKEITFLKNTVMECDACGMQPVRTPGLSVRPLSQCAPGFCYPGVVCTQTPS
GARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPAHEGVG
LAFAKANKQVCTDINECETGQHNCVPNSVCVNTQGSFQCGPCQPGFVGDQTSGCKRRSQR
SCPDGTPSPCHEKADCVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQC
RKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVLNEQDNCKLVRNPDQRNADGDKWGDA
CDNCRNQKNDDQKDTDQDGKGDACDDDIDGDRIRNSVDNCPRVPNSDQKDSDGDGVGDAC
DNCPQKSNPDQGDVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDA
CDEDDDNDGVPDSQDNCRLVPNPNQEDLDRDGVGDACQGDFDADKVVDKIDVCPENAEVT
LTDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFH
VNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPG
EQMRNALWHTGDTASQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVA
DSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETQRLLQA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcagagagcaagctgcagtccagctccccgtcgccatggttcctgccaccgcc
tgcgttctcctgctcaccctggccgtcctcggcgcgtcaggtcagggccagatatcacta
ggtgcagatctgggcccgcagatgcttcgggaacttcaggagaccaacgcggcgttgcag
gatgtgcgggagctgttacggcagcaggtcaaggagatcacgtttctgaaaaatacagtg
atggagtgtgatgcgtgcgggatgcagcccgtgcgcaccccgggtctgagcgtgcggccc
ctatcccagtgcgcgcccggcttctgctacccaggcgtggtctgcactcagacgccgagc
ggcgcgcgctgtggaccctgtcccgcgggcttcactggcaatggctcgcactgcaccgac
gtcaacgagtgcaacgcccatccctgcttcccccgcgtccgctgcatcaacaccagcccc
ggcttccgctgcgaggcttgcccgccggggtacagcggccccgctcacgagggcgtgggg
ctggccttcgccaaggccaacaaacaggtttgcacggacattaacgaatgtgagacaggg
cagcataactgcgttcccaactccgtgtgcgtcaatacccagggctccttccagtgcggc
ccttgccagcccggcttcgtaggcgaccagacatctggctgcaagcggcgctcacagcgc
tcctgccccgacggcacgcccagcccgtgccacgagaaggccgactgcgttctggaacgc
gatggctcgcgatcgtgcgtatgcgccgttggctgggcaggcaacgggctcctctgcggc
cgagacacggatttggacggcttccccgacgagaagcttcgctgctcggaacgccagtgc
cgtaaggacaactgtgtgacggtgcccaattcagggcaagaggacgtggatcgcgacggc
atcggagacgcctgcgatccggatgccgatggggacggggtcctcaacgagcaggacaac
tgtaagctggtgcggaacccagaccagcgcaatgcggacggtgacaagtggggtgatgct
tgcgacaactgccggaaccagaagaacgacgaccaaaaggacacagatcaggacggcaaa
ggcgatgcctgcgacgacgacatcgacggcgaccggatccgaaattcggtggacaactgc
ccaagggtgcccaactcagaccagaaggacagcgatggtgatggtgtgggggatgcctgt
gacaactgtccccagaaaagcaacccagaccagggggatgtagaccacgactttgtggga
gacgcttgcgacagcgaccaagaccaggatggggatgggcaccaggactcacgggacaac
tgccctacagtaccaaatagtgcccagcaggattcagaccacgatggccagggtgacgcc
tgcgacgaggatgacgacaacgacggggtccccgacagtcaggacaactgtcgcctggtg
cccaacccaaaccaggaagacctagaccgtgatggagtgggcgacgcgtgccagggcgac
ttcgacgcggacaaggtagtggacaagattgatgtgtgtccggagaacgccgaggtcacc
ctcaccgacttccgggccttccagactgtcgtactggaccccgagggcgacgcgcagata
gatcccaactgggtggtgctcaaccagggtatggagatcgtgcagacgatgaacagcgac
cctggcctggctgtgggctatacggccttcaatggcgtggacttcgaaggcacgttccac
gtgaacacggtcacagatgacgactatgcgggcttcatctttggctaccaggacagctcc
agcttttatgtggttatgtggaagcagatggagcagacgtactggcaggccaatcccttc
cgcgcggtagccgaacccggcattcagctcaaggctgtgaagtcctccacaggccctggg
gagcagatgcggaacgcgctctggcacacaggggacacagcatcacaggtgcggctgctg
tggaaggacccccgcaacgtgggttggaaggacaagacatcctaccgctggttcctgcag
caccggccccaagtgggctacatcagagtgcggttctacgagggccctgagctggtggct
gacagcaacgtggtcctggacacaaccatgcggggtggccgcctgggggtcttttgcttc
tcccaagagaacatcatctgggccaatctacgctaccgatgcaacgacaccatcccagag
gactacgagactcagaggctgctgcaggcctag

DBGET integrated database retrieval system