KEGG   Ailuropoda melanoleuca (giant panda): 100479899Help
Entry
100479899         CDS       T01329                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:aml04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:aml04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:aml04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:aml04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:aml04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPVGGTGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHILGYTL
HPPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSVPRESARITVSKDQSACT
TARVRSKSFLQVCCCVGPSTPSHGETHQVPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctggaaatgcctccgacagttccaactgcacccacccgccggcaccg
gtgaacatatccaaggccattctgctcggggtgatcttggggggcctcatcattttcggc
gtgctgggcaacatcctcgtgatcctctctgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgacctcctgctcacctccaccgtgctg
cccttctcagctatcttcgagatcctgggctactgggcctttggcagagtcttctgcaat
atctgggcggcggtggacgtcctgtgctgcaccgcgtccatcatggggctctgcatcatc
tccatcgaccgctatataggtgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggtctcatggctctgctctgtgtctgggcgctttccctcgtcatctccatcggg
cctctctttggctggaggcagccggccccggaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggcgctgggctccttctacgtgccgctgaccattatc
ctggtcatgtattgccgggtctacgtggtggccaagagggaaagcaggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaggtgacgctccgcatccatcggaaaaat
gtcccagtaggaggcaccggggtgtccagcgccaagaacaagacgcacttctccgtgagg
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccattgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagcattttggctcggatacctaaacagctgc
atcaaccccattatatacccgtgctccagtcaagagtttaaaaaggcctttcagaatgtc
ttgagaatccagtgtctccgcagaaagcagtcttctaaacatatcctgggctataccctg
cacccgcccagccacgccctggaggggcagcacaaggacctggtgcgcatcccagtggga
tcaggagagaccttctataagatctccaagacggatggggtctgtgaatggaaatttttc
tcttcagtgccccgtgaatctgccaggattacagtgtccaaagaccagtcagcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggtgtgctgctgtgtggggccctcgacc
cccagccatggagagacccaccaagttccaaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctag

DBGET integrated database retrieval system