KEGG   Ailuropoda melanoleuca (giant panda): 100479899Help
Entry
100479899         CDS       T01329                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100479899
   04022 cGMP - PKG signaling pathway
    100479899
   04152 AMPK signaling pathway
    100479899
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100479899
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100479899
   04270 Vascular smooth muscle contraction
    100479899
  Digestive system
   04970 Salivary secretion
    100479899
G protein-coupled receptors [BR:aml04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100479899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPVGGTGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHILGYTL
HPPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSVPRESARITVSKDQSACT
TARVRSKSFLQVCCCVGPSTPSHGETHQVPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctggaaatgcctccgacagttccaactgcacccacccgccggcaccg
gtgaacatatccaaggccattctgctcggggtgatcttggggggcctcatcattttcggc
gtgctgggcaacatcctcgtgatcctctctgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgacctcctgctcacctccaccgtgctg
cccttctcagctatcttcgagatcctgggctactgggcctttggcagagtcttctgcaat
atctgggcggcggtggacgtcctgtgctgcaccgcgtccatcatggggctctgcatcatc
tccatcgaccgctatataggtgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggtctcatggctctgctctgtgtctgggcgctttccctcgtcatctccatcggg
cctctctttggctggaggcagccggccccggaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggcgctgggctccttctacgtgccgctgaccattatc
ctggtcatgtattgccgggtctacgtggtggccaagagggaaagcaggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaggtgacgctccgcatccatcggaaaaat
gtcccagtaggaggcaccggggtgtccagcgccaagaacaagacgcacttctccgtgagg
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccattgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagcattttggctcggatacctaaacagctgc
atcaaccccattatatacccgtgctccagtcaagagtttaaaaaggcctttcagaatgtc
ttgagaatccagtgtctccgcagaaagcagtcttctaaacatatcctgggctataccctg
cacccgcccagccacgccctggaggggcagcacaaggacctggtgcgcatcccagtggga
tcaggagagaccttctataagatctccaagacggatggggtctgtgaatggaaatttttc
tcttcagtgccccgtgaatctgccaggattacagtgtccaaagaccagtcagcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggtgtgctgctgtgtggggccctcgacc
cccagccatggagagacccaccaagttccaaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctag

DBGET integrated database retrieval system