KEGG   Ailuropoda melanoleuca (giant panda): 100479903Help
Entry
100479903         CDS       T01329                                 

Definition
(RefSeq) phosphoglycerate mutase 1-like
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100479903
   01230 Biosynthesis of amino acids
    100479903
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100479903
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100479903
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100479903
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100479903
Enzymes [BR:aml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100479903
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100479903
  Exosomal proteins of melanoma cells
   100479903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESTWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatacaagctggtgctgatccggcacggcgagagcacttggaacctggagaac
cgctttagcggctggtacgacgccgacctgagccctgccgggcacgaggaggcgaagcgt
ggcgggcaggcgctgcgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcaattcggactctctggacagtgctggatgccattgaccaaatgtggctgcca
gtagtgaggacttggcgcctcaatgagcggcactatgggggtctgactggccttaataaa
gcagaaactgctgccaagcatggtgaggcccaggtgaagatctggaggcgttcctatgat
gtcccaccacctccaatggaacctgaccatcccttctacagcaacatcagtaaggatcga
aggtatgcagacctcactgaagatcagcttccctcctgtgagagtctgaaggacacaatt
gccagagctctgcccttttggaatgaagaaatagttccccagatcaaggaggggaaacga
gtactgattgcagcccatggcaacagccttcggggcattgtcaagcatctggagggtctt
tctgaagaggctatcatggagctgaacctgccaacaggtattcccatggtctatgaactg
gacaagaacttgaagcccatcaagcccatgcagttcctgggggatgaagagaccgtgcgt
aaagccatggaagccgtggctgcccagggcaaggccaaaaagtga

DBGET integrated database retrieval system