KEGG   Ailuropoda melanoleuca (giant panda): 100479949Help
Entry
100479949         CDS       T01329                                 

Definition
(RefSeq) chymotrypsinogen B-like
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100479949
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100479949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 398 aa AA seqDB search
MAFLWVVLGFLLFGSSSDSTDHTGPASSWPPPYARKWGQERGHQGSCNTHLPGSMLLWRE
EHSDPELLLLQTRGLREHRGLRQDIPAPRLRTLGSYEWDGGSSQGTQWEGLSALQWPKLR
VLGGHRGLEVPGLSPWPLGAPSTDQLPWPWPPGCGVPAIRPELSGLSRIINGEDAVSSSW
PWQVSLQTGSGFHFCGGSLISQHWVVTAAHCRVRKGHRVVAGVSDHGSDDEAVQVLRIEE
VFEHPLWDRAADTNDIALLKLATPALLSDTVSPVCLPSGNASFPTGSICATTGWGRTQYN
SHKTPDKLQQAALPLLSNAECKQFWGSRITDVMVCAGANGISSCMGDSGGPLVCQKDGAW
TLVGIVSWGSSQCNPFSPGVYARVTKFIPWLLGVLEAN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctgggttgtccttggctttctcctctttggcagcagctccgattccact
gatcacactggacctgcctcatcttggcctcctccttacgctcggaagtggggtcaggag
cggggtcatcagggctcctgcaacacccaccttcctgggtctatgctgctctggcgggag
gaacactctgaccccgagctgctgctgctgcagactcgggggctcagagagcaccggggc
ctcaggcaggacatcccggccccacgactcaggaccctgggttcctatgagtgggatgga
ggctcttctcagggcacacagtgggaggggctgagtgccctgcagtggccaaagctccgg
gtgctaggtggccacagaggcctggaagtgccgggtctttccccttggcccctcggggcc
ccatccactgaccagctgccctggccctggcccccaggctgcggggtccctgccatccgc
cccgagctgagtggactgtcccggatcatcaatggagaggacgctgtctccagctcctgg
ccctggcaggtgtccctgcagactggctccggcttccacttctgcgggggctccctcatc
agccagcactgggtggtcactgctgcccactgcagggtcaggaagggccaccgtgtggtg
gccggggtgtctgatcatggctctgatgacgaggctgtccaggtgctgaggatcgaggag
gttttcgaacacccgctgtgggacagggctgcagacaccaatgacatcgccctgctgaag
ctggccacacctgccctgctctccgacaccgtgtcccccgtgtgcctgcccagcggcaac
gccagcttccccacgggctccatctgcgccaccacaggctggggcaggacccagtacaac
tcccacaagacccccgacaagctgcagcaggcggccctgcccctcctgtccaatgccgag
tgcaagcagttctggggcagcaggatcaccgatgtgatggtctgtgcgggcgccaacggc
atctcctcctgcatgggcgactctggtggccccctggtctgccagaaggatggagcctgg
accctggtgggcatcgtgtcctggggcagcagccagtgcaacccattctcaccaggggtg
tacgcccgcgtcaccaagttcattccctggcttctcggggttctggaggccaactga

DBGET integrated database retrieval system