KEGG   Ailuropoda melanoleuca (giant panda): 100479949Help
Entry
100479949         CDS       T01329                                 

Definition
chymotrypsinogen B-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWVVLGFLLFGSSSGCGVPAIRPELSGLSRIINGEDAVSSSWPWQVSLQTGSGFHFC
GGSLISQHWVVTAAHCRVRKGHRVVAGVSDHGSDDEAVQVLRIEEVFEHPLWDRAADTND
IALLKLATPALLSDTVSPVCLPSGNASFPTGSICATTGWGRTQYNSHKTPDKLQQAALPL
LSNAECKQFWGSRITDVMVCAGANGISSCMGDSGGPLVCQKDGAWTLVGIVSWGSSQCNP
FSPGVYARVTKFIPWLLGVLEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctgggttgtccttggctttctcctctttggcagcagctccggctgcggg
gtccctgccatccgccccgagctgagtggactgtcccggatcatcaatggagaggacgct
gtctccagctcctggccctggcaggtgtccctgcagactggctccggcttccacttctgc
gggggctccctcatcagccagcactgggtggtcactgctgcccactgcagggtcaggaag
ggccaccgtgtggtggccggggtgtctgatcatggctctgatgacgaggctgtccaggtg
ctgaggatcgaggaggttttcgaacacccgctgtgggacagggctgcagacaccaatgac
atcgccctgctgaagctggccacacctgccctgctctccgacaccgtgtcccccgtgtgc
ctgcccagcggcaacgccagcttccccacgggctccatctgcgccaccacaggctggggc
aggacccagtacaactcccacaagacccccgacaagctgcagcaggcggccctgcccctc
ctgtccaatgccgagtgcaagcagttctggggcagcaggatcaccgatgtgatggtctgt
gcgggcgccaacggcatctcctcctgcatgggcgactctggtggccccctggtctgccag
aaggatggagcctggaccctggtgggcatcgtgtcctggggcagcagccagtgcaaccca
ttctcaccaggggtgtacgcccgcgtcaccaagttcattccctggcttctcggggttctg
gaggccaactga

DBGET integrated database retrieval system