KEGG   Ailuropoda melanoleuca (giant panda): 100480008Help
Entry
100480008         CDS       T01329                                 

Definition
CREB-binding protein-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100480008
   04330 Notch signaling pathway
    100480008
   04350 TGF-beta signaling pathway
    100480008
   04630 Jak-STAT signaling pathway
    100480008
   04066 HIF-1 signaling pathway
    100480008
   04068 FoxO signaling pathway
    100480008
   04024 cAMP signaling pathway
    100480008
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100480008
  Cellular commiunity
   04520 Adherens junction
    100480008
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100480008
   04916 Melanogenesis
    100480008
  Nervous system
   04720 Long-term potentiation
    100480008
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480008
   05206 MicroRNAs in cancer
    100480008
   05203 Viral carcinogenesis
    100480008
   05211 Renal cell carcinoma
    100480008
   05215 Prostate cancer
    100480008
  Neurodegenerative diseases
   05016 Huntington's disease
    100480008
  Infectious diseases
   05152 Tuberculosis
    100480008
   05166 HTLV-I infection
    100480008
   05164 Influenza A
    100480008
   05161 Hepatitis B
    100480008
   05168 Herpes simplex infection
    100480008
   05169 Epstein-Barr virus infection
    100480008
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100480008
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100480008
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100480008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2504 aa AA seqDB search
MNGISALIKDLESSLTPSTMYTGVAPSSRSPRGRTPAWSPRGVLGGCRGGGAPETSRPEA
LMEGAPPPRRQRPPPRVQGTRRVAGIRRGEVTRPGENGRELADGLPNPKRAKLSSPGFSA
NDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINP
GIGNVSASSPVQQGLGGQAPGQPNSANMASLGAMGKSPLNQGDSAAPSLPKQAASTSGPT
PPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQG
QAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMASHAGLNTAQAGGM
TKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSKQSMVNSLPPFPTDIKNASVTNVPN
MSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPH
CRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQT
ILGSPATGIQNTIGSVGTGQQNAASLSNPNPIDPSSMQRAYAALGLPYLNQPQTQLQPQV
PGQQPAQPPTHQQMRTLNPLGNNPVNIPAGGITTDQQPPNLISESALPASLGATNPLMND
GSSPANIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDR
RMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPA
LPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQGMNSFTPMSLGNVQLPQAPMGPRAA
SPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHANNIMAQAPAQNQFLPQNQFQSSSG
AMSVNSVGMGQPAAQTGVPQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHQTPPPAS
TAAGMPSLQHPTAPGMTPPQPAAPTQPSTPASSSGQTPTPTPGSVPSASQTQSTPTVQAA
AQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASA
ETNSQQPGPDVPMLEVKAEVKTEDTEPDASESKVEPGSAMMEEDLQGSSQVKEETDTTEQ
KVEPMEVDEKKPEVKVEAKEEEENSANGAASQSTSPSQPRKKIFKPEELRQALMPTLEAL
YRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMF
NNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTI
PRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFV
DCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDR
VNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEE
IDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYV
KKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKD
IFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGD
SKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGP
VINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQD
RFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQS
KSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQ
LIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQS
LPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSRTSXXXXXXXXVEAARQIEREAQQQQ
HLYRVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQAPXXXLQ
PMPGMPRPVLSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNIL
KSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNTMQAGGPRPGVPP
QQQAMGGLNPQGQALNIMNPGHNPGMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQG
STGMAGAMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQLGQMGQPG
LGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATS
LSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQG
HLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggattagtgcccttataaaagacctggagagctccctgaccccttccaccatg
tacacgggagtggccccctcgagccggtctccccggggccgcacacctgcctggagcccc
cgcggggtgctaggtggatgtcggggcgggggcgctcctgagacgtcaaggcccgaagcc
ctgatggaaggggcccccccgcccaggaggcagcgcccaccacctcgagtgcaggggacc
cgacgcgtcgctggcatccggcgaggggaggtgaccaggcctggtgaaaatggccgagaa
cttgctgacggacttcccaaccccaaacgagccaaactcagctcgcccggcttctcggcg
aatgacagcacagattttggatcattgtttgacttggaaaatgatcttcctgatgagctg
atccccaatggaggagaattaagccttttaaacagtgggaaccttgttccagatgctgct
tccaaacataaacaactgtcggagctcctgcgcggaggcagcggctccagtatcaaccca
ggaataggaaatgttagcgccagcagccccgtgcagcaaggccttggcggccaggctcca
gggcagccgaacagtgcaaacatggccagcttgggtgccatgggcaagagccctctgaac
cagggagattctgcagcccccagcctgcccaaacaggcagccagcacctctgggcccact
ccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtggggctggtgaccagc
agccctgccacgtcgcagacgggacctgggatctgcatgaatgctaactttaaccagacc
cacccaggcctcctcaatagtaactctggccatagtttaatgaaccaagcccagcaagga
caggcgcaagtcatgaatggatctcttggggccgctggcagaggaaggggagctgggatg
ccgtaccctgctccggccatgcagggggccacgagcagcgtgctggctgagacattaaca
caggtttcacctcaaatggccagtcacgccggactgaacacagcgcaggcaggaggcatg
accaagatgggaatgactggtaacacaagtccattcggacagccctttagtcaaactgga
gggcagcaaatgggagcccctggagtgaacccccagttatccagcaaacagagcatggtc
aatagtttgcctcccttccctacagacatcaagaatgcttcagtcaccaacgtgccaaac
atgtctcagatgcagacttcagtgggaattgtccccacacaggcgatcgccgcaggcccc
actgcagatccggagaagcgcaaactgatacagcagcaactggtcctcctgcttcacgct
cataagtgtcagagacgagaacaagcgaacggagaggttcgggcctgctctctcccacat
tgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggctgggaaagcctgt
caagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaactgcacacga
catgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaaccaacaaacc
atcctggggtctccagctactgggattcagaacacgattggttctgttggcacaggccag
cagaatgccgcgtctctaagtaacccaaatcccatagaccccagttccatgcagcgtgcg
tacgctgcccttggactcccctacctgaaccagccccagacacagctgcagcctcaggtc
cccggccagcaaccagcacagcctccaactcaccagcagatgaggaccctcaaccccctg
ggaaataacccagtgaacattccagcaggaggaataacaacagatcagcagccaccaaac
ttgatttcagaatcagctcttccagcttcccttggggccacaaatccactgatgaacgat
ggctcaagccctgcaaacattgggaccctcagcaccatacctacagcggccccaccttcc
agcaccggcgttcggaaaggctggcacgaacatgtcactcaggacctgcggagccatcta
gtgcataaactcgtccaagccatctttccaacccctgacccggcagccctgaaggatcgc
cgcatggagaacctggtggcctacgccaagaaagtggagggggacatgtatgagtctgcc
aacagcagggatgaatactatcatttactggcagaaaaaatctacaagatacaaaaagaa
ctagaagaaaaacggaggtcgcgtttgcacaaacaaggcatcttgggtaaccagcccgcc
ctgccggctcccggggcacagcccccagggattccacaggcacagcctgtgaggcctcca
aacggacccatgcccctgccagtgaaccgcgtgcaggtgtcccaagggatgaattcattt
accccaatgtccttggggaatgtacagttgccacaagctcccatgggaccgcgtgcagca
tcccccatgaaccactctgtcccgatgaacagcatgggctccgttcccgggatggccatt
tccccttcccgaatgcctcagcctccaaacatgatgggcgctcacgccaacaacattatg
gcccaggcacctgcgcagaaccagttcctgccacagaaccagttccagtcctccagtggg
gcgatgagtgtgaacagtgtgggcatgggtcagccggcggcccagacaggcgtgccacag
ggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttgggccccaggccagc
cagctgccctgcccaccagtgacacagtcaccgttgcaccagacgccacctcctgcttcc
acggccgctggcatgccatctctccagcacccgacggcacctgggatgacccctccccag
ccagcagctcccacccagccatcgactcccgcgtcgtcttccgggcagactcccaccccg
actcccggctcagtgcccagtgctagccaaacccagagcacccctacggtccaggcagca
gcccaggcccaggtgaccccacagcctcagaccccagtccagcccccgtctgtggccacc
ccacagtcatcacagcagcagccgacacctgtgcacgcccagcctcctggcacaccgctt
tcccaggcagcagccagcatcgataacagggtccccactccttcctcggtggccagcgcc
gaaaccaactcccagcagccgggacccgatgtaccaatgctggaggtgaaggcagaggtc
aagaccgaggacactgagcctgacgccagtgaatccaaggtggagcctggatctgcgatg
atggaggaggatcttcaagggtcttctcaggttaaggaagaaacagacacaacagaacag
aaagtagaaccaatggaagtggacgagaagaaaccggaagtcaaagtagaagctaaagag
gaagaagagaacagcgctaacggagctgcctctcagtcaacgtctccctcacagccacgc
aaaaagatctttaagccggaggagttacgccaggctctgatgccaaccctcgaagcgttg
tatcgacaggatccggagtccctaccttttcggcagcctgtagatccccagctcctagga
attccggattattttgacattgtgaagaatcccatggacctttccaccatcaagcggaag
ctggatacagggcagtaccaagagccctggcagtatgtggacgatgtctggcttatgttc
aacaatgcctggctctataatcgtaagacgtcccgggtctataagttctgcagtaaactt
gcagaggtctttgagcaagaaattgaccctgttatgcagtcccttggatattgctgtgga
cgaaagtatgagttttccccacagactttgtgctgctacgggaagcagctgtgtacaatt
cctcgtgacgctgcctactacagctatcagaataggtatcatttctgtgagaagtgtttc
acagagatccagggggagaatgttaccctgggtgacgacccttcacagccccagacgaca
atttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaaccttttgtc
gattgcaaggagtgtggccggaagatgcatcagatttgtgttctacactatgacatcatt
tggccttcaggctttgtgtgcgacaactgtttgaagaaaactggcagaactcggaaagaa
aacaagttcagtgctaagagactacagaccacacgattgggcaaccatttggaagaccga
gtcaacaagtttttgcggcgacagaatcatcctgaagccggggaggtctttgtccgtgtg
gtggccagctcagacaagactgtggaagtcaagcctgggatgaagtcacggttcgtggat
tctggggaaatgtctgaatctttcccgtatcgaaccaaagcactctttgcttttgaggaa
attgacggtgtggatgtgtgcttctttgggatgcatgtgcaggagtacggctctgactgc
ccccctccaaacacaaggcgtgtgtacatatcttacctggacagtattcatttcttccgg
ccccgatgcctccggacagctgtttaccatgagatccttattggttatttagaatatgtg
aagaaattggggtatgtaacaggacacatctgggcctgccccccaagtgaaggagacgac
tatatcttccattgccacccccctgatcagaaaatccccaaaccaaagcgcctccaggag
tggtacaagaagatgctggacaaggcgtttgcggagcggatcattcacgactacaaggac
attttcaaacaagcaactgaagacaggctcaccagtgccaaggagctgccctattttgag
ggtgacttctggcctaatgtgctggaggagagcattaaggagctggagcaagaagaagag
gagaggaagaaggaggagagcactgcggccagcgagaccacagagggcagccagggtgac
agcaagaatgccaagaagaagaacaacaaaaaaaccaacaagaataaaagcagcatcagt
cgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacttgtcccagaagctc
tatgccaccatggagaagcacaaagaggtcttctttgtgatccacctgcacgctgggcct
gtcatcaacacactgccccccatcgttgaccctgaccccctgctcagctgtgacctcatg
gacgggcgtgacgccttcctcaccctcgccagagacaagcactgggagttctcctccttg
cgccggtccaagtggtccacattgtgcatgctggtggagctgcacacccagggccaggac
cgcttcgtctacacctgcaatgagtgcaagcaccatgtggagacgcgctggcactgcacc
gtgtgcgaggactacgacctttgcatcaactgctacaacacgaagagccacgcccacaag
atggtgaagtgggggctgggcctggacgacgagggcagcagccagggcgagccgcagtcc
aagagcccccaggagtcacggcgcctgagcatccagcgctgcatccagtccctggtgcac
gcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaagatgaagcgggtg
gtgcagcacaccaagggctgcaagcgcaagaccaacgggggctgcccggtgtgcaagcag
ctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaaatgcccggtgccc
ttctgcctcaacatcaaacataagctccgccagcagcagatccagcaccgcctgcagcaa
gcccagctcatgcgccggcggatggccaccatgaacacccgcaatgtgcctcagcagagc
ctgccttcccctacctcagctccgcccgggacccccacgcagcagcccagcacgccccag
acaccgcagcccccagcccagccccagccctcgcccgtgagcaggacatcnnnnnnnnnn
nnnnnnnnnnnnnnggtggaagcagcccggcagatcgagcgggaggcccagcagcagcag
cacctgtaccgggtgaacatcaacaatggcatgcccccggggcgcacgggcatggtgacc
ccggtgagccagatggcccccgtgggcttgaacgtgccccgtcccaaccaggtcagcggg
cccgtcatgcccaacctgccgcccgggcagtggcagcaggcgccnnnnnnnnnnctgcag
ccgatgccgggcatgccccggcccgtgctgtccatgcaggcccagccggccgtggccggg
ccgcggatgtccggcgtgcagccgccccggagcatctcgcctggcgccctgcaggacctg
ctgcggaccctgaagtcgcccagctccccgcagcagcagcagcaggtgctcaacatcctc
aagtccaaccctcagctgatggcggccttcatcaagcagcgcacggccaagtacgtggcc
agtcagcccggcctgcagccccagcccggcctccaggcccagcctggcctgcaccagcag
cccggcctgcagaacctgaacaccatgcaagccggcgggccccggcccggcgtgcctccg
cagcagcaggcgatgggcggcctgaacccccagggccaggccctgaacatcatgaacccg
ggccacaaccccggcatggcgagtatgaacccgcagtaccgggagatgctccggaggcag
ctgctccagcagcagcagcaacagcaacagcagcagcagcagcagcagcagcagcagggc
agcacgggcatggccggggccatggccgggcacggccagttccagcagccccagggaccc
ggaggctaccccccagccatgcagcagcagcggatgcagcagcacctccccatccagggc
agctccatgggccagatggcggctcagatgggacagctcggccagatggggcagccgggg
ctgggcgcagacagcacccccaacatccagcaggccctgcagcagcggattctgcagcag
cagcagatgaagcagcagattgggtccccgggccagccgaaccccatgagcccccagcag
cacatgctctcaggacagccgcaggcctcgcacctccccggccagcagatggccacgtcc
ctcagtagccaggtgcggtctccagcccctgtccagtctccgcggccccagtcccagcct
ccacattccagcccgtcgccacggatacagccccagccttcgccacaccacgtctcgccc
cagactggttccccccacccaggactcgcagtcaccatggccagctccatagatcaggga
cacttggggaaccccgaacagagtgcaatgctcccacagctgaacacccccaacaggagt
gcgttgtccagtgagctgtccctggtcggcgacaccacaggagacaccctagaaaagttt
gtggagggtttgtag

DBGET integrated database retrieval system