KEGG   Ailuropoda melanoleuca (giant panda): 100480008Help
Entry
100480008         CDS       T01329                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Glucagon signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100480008 (CREBBP)
   04330 Notch signaling pathway
    100480008 (CREBBP)
   04350 TGF-beta signaling pathway
    100480008 (CREBBP)
   04630 Jak-STAT signaling pathway
    100480008 (CREBBP)
   04066 HIF-1 signaling pathway
    100480008 (CREBBP)
   04068 FoxO signaling pathway
    100480008 (CREBBP)
   04024 cAMP signaling pathway
    100480008 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100480008 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    100480008 (CREBBP)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100480008 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100480008 (CREBBP)
   04916 Melanogenesis
    100480008 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    100480008 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480008 (CREBBP)
   05206 MicroRNAs in cancer
    100480008 (CREBBP)
   05203 Viral carcinogenesis
    100480008 (CREBBP)
   05211 Renal cell carcinoma
    100480008 (CREBBP)
   05215 Prostate cancer
    100480008 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    100480008 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    100480008 (CREBBP)
   05166 HTLV-I infection
    100480008 (CREBBP)
   05164 Influenza A
    100480008 (CREBBP)
   05161 Hepatitis B
    100480008 (CREBBP)
   05168 Herpes simplex infection
    100480008 (CREBBP)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100480008 (CREBBP)
   05169 Epstein-Barr virus infection
    100480008 (CREBBP)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100480008 (CREBBP)
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100480008 (CREBBP)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100480008 (CREBBP)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100480008 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 2511 aa AA seqDB search
MNGISALIKDLESSLTPSTMYTGVAPSSRSPRGRTPAWSPRGVLGGCRGGGAPETSRPEA
LMEGAPPPRRQRPPPRVQGADPRPGALAGPVARARGCFREQVKMAENLXDGLPNPKRAKL
SSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLVPDAASKHKQLSELLRGG
SGSSINPGIGNVSASSPVQQGLGGQAPGQPNSANMASLGAMGKSPLNQGDSAAPSLPKQA
ASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSL
MNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMASHAGLN
TAQAGGMTKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLSSKQSMVNSLPPFPTDIKNA
SVTNVPNMSQMQTSVGIVPTQAIAAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEV
RACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAS
DKRNQQTILGSPATGIQNTIGSVGTGQQNAASLSNPNPIDPSSMQRAYAALGLPYLNQPQ
TQLQPQVPGQQPAQPPTHQQMRTLNPLGNNPVNIPAGGITTDQQPPNLISESALPASLGA
TNPLMNDGSSPANIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPD
PAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQG
ILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQGMNSFTPMSLGNVQLPQA
PMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHANNIMAQAPAQNQFLPQN
QFQSSSGAMSVNSVGMGQPAAQTGVPQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLH
QTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPASSSGQTPTPTPGSVPSASQTQS
TPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPT
PSSVASAETNSQQPGPDVPMLEVKAEVKTEDTEPDASESKVEPGSAMMEEDLQGSSQVKE
ETDTTEQKVEPMEVDEKKPEVKVEAKEEEENSANGAASQSTSPSQPRKKIFKPEELRQAL
MPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYV
DDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY
GKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDT
LDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRL
GNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTK
ALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEIL
IGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAER
IIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASET
TEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFV
IHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVE
LHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGS
SQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNG
GCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNT
RNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSRTSXXXXXXXXVEAARQIE
REAQQQQHLYRVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVMPNLPPGQWQQ
APXXXLQPMPGMPRPVLSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQ
QQVLNILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNTMQAGG
PRPGVPPQQQAMGGLNPQGQALNIMNPGHNPGMASMNPQYREMLRRQLLQQQQQQQQQQQ
QQQQQQGSTGMAGAMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQL
GQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLP
GQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTM
ASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7536 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggattagtgcccttataaaagacctggagagctccctgaccccttccaccatg
tacacgggagtggccccctcgagccggtctccccggggccgcacacctgcctggagcccc
cgcggggtgctaggtggatgtcggggcgggggcgctcctgagacgtcaaggcccgaagcc
ctgatggaaggggcccccccgcccaggaggcagcgcccaccacctcgagtgcagggcgcc
gacccccgccccggagcccttgccggcccggttgcccgcgctcggggctgtttccgcgag
caggtgaaaatggccgagaacttgnctgacggacttcccaaccccaaacgagccaaactc
agctcgcccggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaa
aatgatcttcctgatgagctgatccccaatggaggagaattaagccttttaaacagtggg
aaccttgttccagatgctgcttccaaacataaacaactgtcggagctcctgcgcggaggc
agcggctccagtatcaacccaggaataggaaatgttagcgccagcagccccgtgcagcaa
ggccttggcggccaggctccagggcagccgaacagtgcaaacatggccagcttgggtgcc
atgggcaagagccctctgaaccagggagattctgcagcccccagcctgcccaaacaggca
gccagcacctctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaag
caagtggggctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatg
aatgctaactttaaccagacccacccaggcctcctcaatagtaactctggccatagttta
atgaaccaagcccagcaaggacaggcgcaagtcatgaatggatctcttggggccgctggc
agaggaaggggagctgggatgccgtaccctgctccggccatgcagggggccacgagcagc
gtgctggctgagacattaacacaggtttcacctcaaatggccagtcacgccggactgaac
acagcgcaggcaggaggcatgaccaagatgggaatgactggtaacacaagtccattcgga
cagccctttagtcaaactggagggcagcaaatgggagcccctggagtgaacccccagtta
tccagcaaacagagcatggtcaatagtttgcctcccttccctacagacatcaagaatgct
tcagtcaccaacgtgccaaacatgtctcagatgcagacttcagtgggaattgtccccaca
caggcgatcgccgcaggccccactgcagatccggagaagcgcaaactgatacagcagcaa
ctggtcctcctgcttcacgctcataagtgtcagagacgagaacaagcgaacggagaggtt
cgggcctgctctctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacacat
tgtcaggctgggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctct
cattggaagaactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagt
gacaagcgaaaccaacaaaccatcctggggtctccagctactgggattcagaacacgatt
ggttctgttggcacaggccagcagaatgccgcgtctctaagtaacccaaatcccatagac
cccagttccatgcagcgtgcgtacgctgcccttggactcccctacctgaaccagccccag
acacagctgcagcctcaggtccccggccagcaaccagcacagcctccaactcaccagcag
atgaggaccctcaaccccctgggaaataacccagtgaacattccagcaggaggaataaca
acagatcagcagccaccaaacttgatttcagaatcagctcttccagcttcccttggggcc
acaaatccactgatgaacgatggctcaagccctgcaaacattgggaccctcagcaccata
cctacagcggccccaccttccagcaccggcgttcggaaaggctggcacgaacatgtcact
caggacctgcggagccatctagtgcataaactcgtccaagccatctttccaacccctgac
ccggcagccctgaaggatcgccgcatggagaacctggtggcctacgccaagaaagtggag
ggggacatgtatgagtctgccaacagcagggatgaatactatcatttactggcagaaaaa
atctacaagatacaaaaagaactagaagaaaaacggaggtcgcgtttgcacaaacaaggc
atcttgggtaaccagcccgccctgccggctcccggggcacagcccccagggattccacag
gcacagcctgtgaggcctccaaacggacccatgcccctgccagtgaaccgcgtgcaggtg
tcccaagggatgaattcatttaccccaatgtccttggggaatgtacagttgccacaagct
cccatgggaccgcgtgcagcatcccccatgaaccactctgtcccgatgaacagcatgggc
tccgttcccgggatggccatttccccttcccgaatgcctcagcctccaaacatgatgggc
gctcacgccaacaacattatggcccaggcacctgcgcagaaccagttcctgccacagaac
cagttccagtcctccagtggggcgatgagtgtgaacagtgtgggcatgggtcagccggcg
gcccagacaggcgtgccacagggacaggtgcctggtgctgctcttcctaaccctctgaac
atgcttgggccccaggccagccagctgccctgcccaccagtgacacagtcaccgttgcac
cagacgccacctcctgcttccacggccgctggcatgccatctctccagcacccgacggca
cctgggatgacccctccccagccagcagctcccacccagccatcgactcccgcgtcgtct
tccgggcagactcccaccccgactcccggctcagtgcccagtgctagccaaacccagagc
acccctacggtccaggcagcagcccaggcccaggtgaccccacagcctcagaccccagtc
cagcccccgtctgtggccaccccacagtcatcacagcagcagccgacacctgtgcacgcc
cagcctcctggcacaccgctttcccaggcagcagccagcatcgataacagggtccccact
ccttcctcggtggccagcgccgaaaccaactcccagcagccgggacccgatgtaccaatg
ctggaggtgaaggcagaggtcaagaccgaggacactgagcctgacgccagtgaatccaag
gtggagcctggatctgcgatgatggaggaggatcttcaagggtcttctcaggttaaggaa
gaaacagacacaacagaacagaaagtagaaccaatggaagtggacgagaagaaaccggaa
gtcaaagtagaagctaaagaggaagaagagaacagcgctaacggagctgcctctcagtca
acgtctccctcacagccacgcaaaaagatctttaagccggaggagttacgccaggctctg
atgccaaccctcgaagcgttgtatcgacaggatccggagtccctaccttttcggcagcct
gtagatccccagctcctaggaattccggattattttgacattgtgaagaatcccatggac
ctttccaccatcaagcggaagctggatacagggcagtaccaagagccctggcagtatgtg
gacgatgtctggcttatgttcaacaatgcctggctctataatcgtaagacgtcccgggtc
tataagttctgcagtaaacttgcagaggtctttgagcaagaaattgaccctgttatgcag
tcccttggatattgctgtggacgaaagtatgagttttccccacagactttgtgctgctac
gggaagcagctgtgtacaattcctcgtgacgctgcctactacagctatcagaataggtat
catttctgtgagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgac
ccttcacagccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgatacc
ttagatcctgaaccttttgtcgattgcaaggagtgtggccggaagatgcatcagatttgt
gttctacactatgacatcatttggccttcaggctttgtgtgcgacaactgtttgaagaaa
actggcagaactcggaaagaaaacaagttcagtgctaagagactacagaccacacgattg
ggcaaccatttggaagaccgagtcaacaagtttttgcggcgacagaatcatcctgaagcc
ggggaggtctttgtccgtgtggtggccagctcagacaagactgtggaagtcaagcctggg
atgaagtcacggttcgtggattctggggaaatgtctgaatctttcccgtatcgaaccaaa
gcactctttgcttttgaggaaattgacggtgtggatgtgtgcttctttgggatgcatgtg
caggagtacggctctgactgcccccctccaaacacaaggcgtgtgtacatatcttacctg
gacagtattcatttcttccggccccgatgcctccggacagctgtttaccatgagatcctt
attggttatttagaatatgtgaagaaattggggtatgtaacaggacacatctgggcctgc
cccccaagtgaaggagacgactatatcttccattgccacccccctgatcagaaaatcccc
aaaccaaagcgcctccaggagtggtacaagaagatgctggacaaggcgtttgcggagcgg
atcattcacgactacaaggacattttcaaacaagcaactgaagacaggctcaccagtgcc
aaggagctgccctattttgagggtgacttctggcctaatgtgctggaggagagcattaag
gagctggagcaagaagaagaggagaggaagaaggaggagagcactgcggccagcgagacc
acagagggcagccagggtgacagcaagaatgccaagaagaagaacaacaaaaaaaccaac
aagaataaaagcagcatcagtcgagccaacaagaagaagcccagcatgcccaacgtgtcc
aacgacttgtcccagaagctctatgccaccatggagaagcacaaagaggtcttctttgtg
atccacctgcacgctgggcctgtcatcaacacactgccccccatcgttgaccctgacccc
ctgctcagctgtgacctcatggacgggcgtgacgccttcctcaccctcgccagagacaag
cactgggagttctcctccttgcgccggtccaagtggtccacattgtgcatgctggtggag
ctgcacacccagggccaggaccgcttcgtctacacctgcaatgagtgcaagcaccatgtg
gagacgcgctggcactgcaccgtgtgcgaggactacgacctttgcatcaactgctacaac
acgaagagccacgcccacaagatggtgaagtgggggctgggcctggacgacgagggcagc
agccagggcgagccgcagtccaagagcccccaggagtcacggcgcctgagcatccagcgc
tgcatccagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcc
tgccagaagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggg
ggctgcccggtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaa
gaaaacaaatgcccggtgcccttctgcctcaacatcaaacataagctccgccagcagcag
atccagcaccgcctgcagcaagcccagctcatgcgccggcggatggccaccatgaacacc
cgcaatgtgcctcagcagagcctgccttcccctacctcagctccgcccgggacccccacg
cagcagcccagcacgccccagacaccgcagcccccagcccagccccagccctcgcccgtg
agcaggacatcnnnnnnnnnnnnnnnnnnnnnnnnggtggaagcagcccggcagatcgag
cgggaggcccagcagcagcagcacctgtaccgggtgaacatcaacaatggcatgcccccg
gggcgcacgggcatggtgaccccggtgagccagatggcccccgtgggcttgaacgtgccc
cgtcccaaccaggtcagcgggcccgtcatgcccaacctgccgcccgggcagtggcagcag
gcgccnnnnnnnnnnctgcagccgatgccgggcatgccccggcccgtgctgtccatgcag
gcccagccggccgtggccgggccgcggatgtccggcgtgcagccgccccggagcatctcg
cctggcgccctgcaggacctgctgcggaccctgaagtcgcccagctccccgcagcagcag
cagcaggtgctcaacatcctcaagtccaaccctcagctgatggcggccttcatcaagcag
cgcacggccaagtacgtggccagtcagcccggcctgcagccccagcccggcctccaggcc
cagcctggcctgcaccagcagcccggcctgcagaacctgaacaccatgcaagccggcggg
ccccggcccggcgtgcctccgcagcagcaggcgatgggcggcctgaacccccagggccag
gccctgaacatcatgaacccgggccacaaccccggcatggcgagtatgaacccgcagtac
cgggagatgctccggaggcagctgctccagcagcagcagcaacagcaacagcagcagcag
cagcagcagcagcagcagggcagcacgggcatggccggggccatggccgggcacggccag
ttccagcagccccagggacccggaggctaccccccagccatgcagcagcagcggatgcag
cagcacctccccatccagggcagctccatgggccagatggcggctcagatgggacagctc
ggccagatggggcagccggggctgggcgcagacagcacccccaacatccagcaggccctg
cagcagcggattctgcagcagcagcagatgaagcagcagattgggtccccgggccagccg
aaccccatgagcccccagcagcacatgctctcaggacagccgcaggcctcgcacctcccc
ggccagcagatggccacgtccctcagtagccaggtgcggtctccagcccctgtccagtct
ccgcggccccagtcccagcctccacattccagcccgtcgccacggatacagccccagcct
tcgccacaccacgtctcgccccagactggttccccccacccaggactcgcagtcaccatg
gccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccacag
ctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggcgacaccaca
ggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system