KEGG   Ailuropoda melanoleuca (giant panda): 100480084Help
Entry
100480084         CDS       T01329                                 

Definition
apolipoprotein A-IV-like
Orthology
K08760  
apolipoprotein A-IV
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100480084
   04977 Vitamin digestion and absorption
    100480084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 382 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVSADQVATVLWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKIGQVNTYTDNLQKKLVPFATELHERLSKDSEKLKEEIRKELEDLRARLLPHANEV
SQKIGDNMRELQQRFGPYADELRTQVNTQAEQLRNQLASHAQRMQTALRQNVDNLQASLT
PYADELKAKIDQNVEELKGRLTPYADELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKISANADELRQRLGPVAEDVRGKLRDNTQELQKSLAELSSHLDRQV
EEFRRSVGPYGETFNAALLQQVEELRQKLGPYAGDVEDHLSFLEKDLRDKVNSFFSTLKE
KENQDMLVAVSEEQQTLVPLES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtcctgaccctggccctggtggctgtcactggtgcccgggct
gaggtcagtgctgaccaggtggccactgtgctgtgggactactttagtcagctgagcaac
aatgccaaggaagccgtggaacacctccagcagtcggagctcacccagcagctcaatgcc
ctcttccaagacaagattgggcaggtgaacacctacaccgataacctgcagaagaagctg
gtgccctttgccacggagctgcacgaacgcctgagcaaggactccgagaagctgaaggag
gagattcggaaggagctggaggacctgcgggcccggctgctgccccacgccaacgaggtg
agccagaagatcggggacaacatgcgcgagctgcagcagcgcttcgggccgtacgcggat
gagctgcgcacccaggtcaacactcaagccgagcaactgcgaaaccagctggcgtcccat
gcgcagcgcatgcagaccgcgctgcgccagaacgtggacaacctgcaggcctccctgaca
ccctacgcagatgagttgaaggccaagatcgaccagaacgtcgaagagctcaaggggcgc
ctcacgccctacgcggatgagctcaaggtcaagatcgaccagaacgtggaggagctgcgc
cgcagcctggctccctatgcgcaagacgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaacgccgaggagctgaaggccaagatctcggcgaacgcg
gatgagctgcggcagaggctggggcccgtggctgaggacgtgcgtggcaagctgagggac
aacacccaggagctgcagaagtcgctggccgagctgagcagccacctggaccggcaggtg
gaggagttccgccgcagcgtggggccctacggggagaccttcaacgcagcccttctgcag
caggtggaggagctgaggcagaagctgggcccctacgcaggggacgtggaagaccacctg
agcttcctggagaaggacctgagggacaaggtcaactcttttttcagcaccctcaaggag
aaagagaaccaggacatgcttgtggccgtctccgaggagcagcagacactagtcccttta
gagagctga

DBGET integrated database retrieval system