KEGG   Ailuropoda melanoleuca (giant panda): 100480084Help
Entry
100480084         CDS       T01329                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  
apolipoprotein A-IV
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100480084 (APOA4)
   04979 Cholesterol metabolism
    100480084 (APOA4)
   04977 Vitamin digestion and absorption
    100480084 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 382 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVSADQVATVLWDYFSQLSNNAKEAVEHLQQSELTQQLNA
LFQDKIGQVNTYTDNLQKKLVPFATELHERLSKDSEKLKEEIRKELEDLRARLLPHANEV
SQKIGDNMRELQQRFGPYADELRTQVNTQAEQLRNQLASHAQRMQTALRQNVDNLQASLT
PYADELKAKIDQNVEELKGRLTPYADELKVKIDQNVEELRRSLAPYAQDVQEKLNHQLEG
LAFQMKKNAEELKAKISANADELRQRLGPVAEDVRGKLRDNTQELQKSLAELSSHLDRQV
EEFRRSVGPYGETFNAALLQQVEELRQKLGPYAGDVEDHLSFLEKDLRDKVNSFFSTLKE
KENQDMLVAVSEEQQTLVPLES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtcctgaccctggccctggtggctgtcactggtgcccgggct
gaggtcagtgctgaccaggtggccactgtgctgtgggactactttagtcagctgagcaac
aatgccaaggaagccgtggaacacctccagcagtcggagctcacccagcagctcaatgcc
ctcttccaagacaagattgggcaggtgaacacctacaccgataacctgcagaagaagctg
gtgccctttgccacggagctgcacgaacgcctgagcaaggactccgagaagctgaaggag
gagattcggaaggagctggaggacctgcgggcccggctgctgccccacgccaacgaggtg
agccagaagatcggggacaacatgcgcgagctgcagcagcgcttcgggccgtacgcggat
gagctgcgcacccaggtcaacactcaagccgagcaactgcgaaaccagctggcgtcccat
gcgcagcgcatgcagaccgcgctgcgccagaacgtggacaacctgcaggcctccctgaca
ccctacgcagatgagttgaaggccaagatcgaccagaacgtcgaagagctcaaggggcgc
ctcacgccctacgcggatgagctcaaggtcaagatcgaccagaacgtggaggagctgcgc
cgcagcctggctccctatgcgcaagacgtccaggagaagctcaaccaccagctcgagggg
ctggccttccagatgaagaagaacgccgaggagctgaaggccaagatctcggcgaacgcg
gatgagctgcggcagaggctggggcccgtggctgaggacgtgcgtggcaagctgagggac
aacacccaggagctgcagaagtcgctggccgagctgagcagccacctggaccggcaggtg
gaggagttccgccgcagcgtggggccctacggggagaccttcaacgcagcccttctgcag
caggtggaggagctgaggcagaagctgggcccctacgcaggggacgtggaagaccacctg
agcttcctggagaaggacctgagggacaaggtcaactcttttttcagcaccctcaaggag
aaagagaaccaggacatgcttgtggccgtctccgaggagcagcagacactagtcccttta
gagagctga

DBGET integrated database retrieval system