KEGG   Ailuropoda melanoleuca (giant panda): 100480158Help
Entry
100480158         CDS       T01329                                 

Definition
transcription factor p65-like
Orthology
K04735  
transcription factor p65
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100480158
   04010 MAPK signaling pathway
    100480158
   04064 NF-kappa B signaling pathway
    100480158
   04668 TNF signaling pathway
    100480158
   04066 HIF-1 signaling pathway
    100480158
   04024 cAMP signaling pathway
    100480158
   04151 PI3K-Akt signaling pathway
    100480158
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100480158
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100480158
   04621 NOD-like receptor signaling pathway
    100480158
   04622 RIG-I-like receptor signaling pathway
    100480158
   04623 Cytosolic DNA-sensing pathway
    100480158
   04660 T cell receptor signaling pathway
    100480158
   04662 B cell receptor signaling pathway
    100480158
   04062 Chemokine signaling pathway
    100480158
  Endocrine system
   04920 Adipocytokine signaling pathway
    100480158
   04917 Prolactin signaling pathway
    100480158
  Nervous system
   04722 Neurotrophin signaling pathway
    100480158
  Development
   04380 Osteoclast differentiation
    100480158
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100480158
   05202 Transcriptional misregulation in cancers
    100480158
   05203 Viral carcinogenesis
    100480158
   05212 Pancreatic cancer
    100480158
   05221 Acute myeloid leukemia
    100480158
   05220 Chronic myeloid leukemia
    100480158
   05215 Prostate cancer
    100480158
   05222 Small cell lung cancer
    100480158
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    100480158
  Substance dependence
   05030 Cocaine addiction
    100480158
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100480158
  Infectious diseases
   05132 Salmonella infection
    100480158
   05133 Pertussis
    100480158
   05134 Legionellosis
    100480158
   05152 Tuberculosis
    100480158
   05166 HTLV-I infection
    100480158
   05162 Measles
    100480158
   05164 Influenza A
    100480158
   05161 Hepatitis B
    100480158
   05160 Hepatitis C
    100480158
   05168 Herpes simplex infection
    100480158
   05169 Epstein-Barr virus infection
    100480158
   05146 Amoebiasis
    100480158
   05145 Toxoplasmosis
    100480158
   05140 Leishmaniasis
    100480158
   05142 Chagas disease (American trypanosomiasis)
    100480158
Transcription factors [BR:aml03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100480158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 528 aa AA seqDB search
MADLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTPSVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGQIPNQTSALAPAPAPILAQAPAPAPAPPPIPKTTQAGEGTLSEALLHLQ
FDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPMLMEYPEAITRL
VTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctgtttcccctcatcttcccgtctgagcccgcccaggcctctggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagcgggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacactgggccagggacagttcgcatctccctggttaccaaggac
ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat
gaggctgagctctgccccgaccgttgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc
ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctgtgc
ttccaggtgacagtgcgggacccggcaggcaggccccttcgcttgtcacccgtcctctct
catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac
cggaactctgggagctgccttgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct
caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgatcgacaccggattgaggag
aaacgcaaaaggacgtatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccgacctccaccccggcgcattgctgtgccttcccgaagcacaccttcc
gtccccaagccagctccccagccctatccctttacgccgtccctcagcaccatcaacttc
gaggagttctcccccatggtctttccttcggggcagatcccaaaccagacctctgccttg
gccccagcccctgccccaatcctcgcccaggccccagccccagcccctgcccctcccccc
atccccaagaccacccaggccggggaagggacactgtcagaggccctgctgcacctgcag
tttgacgccgacgaagacctgggggccctgctgggcaacagcactgaccccgccgtgttc
acagacctggcatctgtcgacaactctgagtttcagcagctgctgaaccagggtgtatct
gtggccccccacacagccgagcccatgctgatggagtaccctgaggcaataacgcgcctg
gtgacagggtcccagaggccccctgacccagctcctgctcccctgggggcctctgggctc
cccaacggcctcctctcaggggatgaagacttctcctccattgcagacatggacttctca
gcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system