KEGG   Ailuropoda melanoleuca (giant panda): 100480235Help
Entry
100480235         CDS       T01329                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Endocrine resistance
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100480235 (MAPK12)
   04010 MAPK signaling pathway
    100480235 (MAPK12)
   04370 VEGF signaling pathway
    100480235 (MAPK12)
   04668 TNF signaling pathway
    100480235 (MAPK12)
   04068 FoxO signaling pathway
    100480235 (MAPK12)
   04071 Sphingolipid signaling pathway
    100480235 (MAPK12)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100480235 (MAPK12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100480235 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100480235 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100480235 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100480235 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100480235 (MAPK12)
   04660 T cell receptor signaling pathway
    100480235 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100480235 (MAPK12)
   04659 Th17 cell differentiation
    100480235 (MAPK12)
   04657 IL-17 signaling pathway
    100480235 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100480235 (MAPK12)
   04670 Leukocyte transendothelial migration
    100480235 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    100480235 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100480235 (MAPK12)
   04917 Prolactin signaling pathway
    100480235 (MAPK12)
   04926 Relaxin signaling pathway
    100480235 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100480235 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    100480235 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100480235 (MAPK12)
   04722 Neurotrophin signaling pathway
    100480235 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480235 (MAPK12)
  Development
   04380 Osteoclast differentiation
    100480235 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100480235 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100480235 (MAPK12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100480235 (MAPK12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480235 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    100480235 (MAPK12)
   05133 Pertussis
    100480235 (MAPK12)
   05152 Tuberculosis
    100480235 (MAPK12)
   05164 Influenza A
    100480235 (MAPK12)
   05160 Hepatitis C
    100480235 (MAPK12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100480235 (MAPK12)
   05169 Epstein-Barr virus infection
    100480235 (MAPK12)
   05145 Toxoplasmosis
    100480235 (MAPK12)
   05140 Leishmaniasis
    100480235 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    100480235 (MAPK12)
  Drug resistance
   01522 Endocrine resistance
    100480235 (MAPK12)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100480235 (MAPK12)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100480235 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 351 aa AA seqDB search
AWEVRAVYQDLQPVGSGAYGAVWXARARVDSRTGAKVAIKKLYRPFQSELFAKRAYRELR
LLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMLFMGTDLGKLMKHEKLSEDRIQFLVYQ
MLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEV
ILNWMRYTQTVDVWSAGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPADFVQRLQSA
DAKNYMEGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRVTAAEALTHPYFESLRD
TEDEPKAQKYDESFDDMDRTLDEWKRVTYKEVLSFKPPLQLGTKVSKETAL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gcttgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctccggcgcctacggc
gcggtgtggtgagcgcgggctcgggtggacagccgcacgggcgccaaggtggccatcaag
aagctgtaccggcccttccagtcggagctcttcgccaagcgcgcctaccgcgagctgcgc
ctgctcaagcacatgcgccacgagaacgtcatcgggctgctggacgtgttcacgcctgat
gaaaccctggatgatttcacagacttttacctggtgatgctgttcatggggactgacctg
ggaaagctcatgaagcacgagaaactgagcgaggaccgaatccagttccttgtctaccag
atgctgaaggggctgaagtacatccacgctgctggcgtcatccacagggacctgaagcct
ggcaacctggccgtgaatgaggactgtgagctgaagattctggacttcggcctggcgagg
caggcagacagcgaaatgactgggtatgtggtgacccggtggtatcgggcacccgaggtc
atcttgaactggatgcgctacacacagacagtggacgtctggtcagcgggctgcatcatg
gcggagatgatcacggggaagacgctgtttaagggcagtgaccacctggaccagctgaag
gagatcatgaaggtgacagggacgcctcccgctgactttgtgcagaggctgcagagtgcg
gacgcaaagaactacatggagggcctccccgagttggagaagaaggattttgcctccatc
ctgactaatgcaagccctctggctgtgaacctcctggagaaaatgctggtgctagatgca
gagcggcgggtgacggcggccgaggcgctgacccacccctactttgagtcactgcgcgac
acggaggacgagcccaaggcccagaagtacgatgagtccttcgatgatatggaccgcacg
ctggacgagtggaaacgtgtcacatataaagaagtgctcagcttcaagcctcccctgcag
ttggggaccaaggtctccaaggagacggctctgtga

DBGET integrated database retrieval system