KEGG   Ailuropoda melanoleuca (giant panda): 100480347Help
Entry
100480347         CDS       T01329                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100480347
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100480347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 610 aa AA seqDB search
MQVPSPSMREAASMYGTAVAVFLVILVAALQGSAPPKSPFPYRIPLDPKKSLELSWNVSY
TQETVYFQLLVREFKAGVLFGMSDRGELENADLVVLWTDGVKDYFGDAWSDERGQIHLDP
QQDYQLLQAQRTPEGLCLLFKRPFGTCDPKDYFIEDGTVHLVYGILEKPFQSLEAINMSG
LQTGLQRVQLLKPNISIPALPLDVRTMEIRAQHALIPDKETTYWCHVTELPAGFSRHHIV
MYEPIITKGNEALVHHMEVFQCAPQIESVPPFSGPCDSKMKPDRLTYCRHVLAAWALGAK
AFYYPEEVGLAFGGPGSSRFLRLEVHYHNPEKIQGRNDSSGIRLYYTATLRRYDAGIMEL
GLVYTPVMAIPPRETAFVLTGYCTDKCTNLTLPPSGIHIFASQLHTHLTGRKVVTVLARD
GREKEVVNRDDHYSPHFQEIRMLKKIVSVQRGDVLITSCTYDTGDKKLATVGGYGINEEM
CVNYVHYYPQTQLELCKSSVEPGFLQMYFHTVNRFSGEEVCTCPQVSVPERFASVPWNSF
NRDMLKALYGFAPISMHCNKSSAVSFEGEWNWQPLPKIISKLEEPTPRCPASRGQSPANP
TVVSIGGSKS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcatgcgcgaggcggcttccatgtatggtacggcagtggct
gtcttcctggtcatcctggtggccgcgctgcagggctcggcaccccccaagagtcccttc
ccctaccgaatacccctggaccccaagaagtccctggaactctcctggaatgtcagctac
acgcaggagaccgtctacttccagctcctggtgcgggagttcaaggctggggtcctgttt
gggatgtcggaccgtggggagctggagaacgctgacttggttgtgctctggacggatggg
gtcaaggactattttggggatgcctggagtgatgagcggggacagatccacctggacccc
cagcaggattaccagctgctgcaggcgcagaggaccccggaaggcctgtgcctgctcttc
aagaggccctttggcacctgtgaccccaaggattacttcatcgaggacggcaccgtccac
ctggtgtacgggatcttggagaagcctttccagtcgctggaggccatcaacatgtcgggg
ctgcagaccggactccagagggtgcaactgctgaagcccaacatctccatcccggctttg
cccttggacgtgcgcaccatggagatccgcgcccagcacgccctgatccctgacaaggag
accacgtactggtgtcacgtcaccgagcttccggctggcttctcccggcaccacatcgtc
atgtacgagcccatcatcaccaagggcaacgaggccctggtccatcacatggaggtcttc
cagtgcgccccccagatcgagagcgtccccccattcagcgggccctgcgactccaagatg
aagcctgaccgtctcacgtactgccgccacgtgctggccgcctgggccctgggtgccaag
gccttttactacccggaggaagtaggccttgcctttgggggccccgggtcctccaggttt
ctccgtctagaagttcactaccacaacccagagaagatccaaggccggaacgactcctcg
ggcatccgcctgtattacacggccacgctccggcgttacgacgcggggatcatggagctg
gggctggtgtacacgcccgtgatggccatccccccacgggagacggcctttgtccttacc
ggctactgcacggacaagtgcaccaacctgacgctgcctccctcagggatccacatcttc
gcctctcagctccacacacacctgactgggagaaaggtggtcaccgtgctggcccgggat
ggccgagagaaggaggttgtgaaccgggatgaccactacagccctcacttccaggagatc
cgcatgttgaagaagatcgtgtctgtgcagcggggggacgtgctcatcacttcctgcacc
tacgacacgggggacaagaagctggccactgtggggggctacgggatcaacgaggagatg
tgcgtcaactacgtgcactactacccccagacacagctggaactgtgcaagagcagcgtg
gagcccggcttcctgcagatgtacttccacacggtgaacaggttcagtggggaggaagtc
tgcacctgccctcaggtgtctgtccctgagcggtttgcttcggttccctggaactccttc
aatcgagacatgctcaaggccctgtacggcttcgcccccatctccatgcactgcaacaag
tcttcagccgtcagcttcgagggtgaatggaattggcagcccctgcccaagatcatctcc
aagctagaagagcccacccctcggtgtccagccagccggggtcagagccccgccaacccc
actgtggtcagcattggtgggagcaaaagttga

DBGET integrated database retrieval system