KEGG   Ailuropoda melanoleuca (giant panda): 100480347Help
Entry
100480347         CDS       T01329                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aml00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 610 aa AA seqDB search
MQVPSPSMREAASMYGTAVAVFLVILVAALQGSAPPKSPFPYRIPLDPKKSLELSWNVSY
TQETVYFQLLVREFKAGVLFGMSDRGELENADLVVLWTDGVKDYFGDAWSDERGQIHLDP
QQDYQLLQAQRTPEGLCLLFKRPFGTCDPKDYFIEDGTVHLVYGILEKPFQSLEAINMSG
LQTGLQRVQLLKPNISIPALPLDVRTMEIRAQHALIPDKETTYWCHVTELPAGFSRHHIV
MYEPIITKGNEALVHHMEVFQCAPQIESVPPFSGPCDSKMKPDRLTYCRHVLAAWALGAK
AFYYPEEVGLAFGGPGSSRFLRLEVHYHNPEKIQGRNDSSGIRLYYTATLRRYDAGIMEL
GLVYTPVMAIPPRETAFVLTGYCTDKCTNLTLPPSGIHIFASQLHTHLTGRKVVTVLARD
GREKEVVNRDDHYSPHFQEIRMLKKIVSVQRGDVLITSCTYDTGDKKLATVGGYGINEEM
CVNYVHYYPQTQLELCKSSVEPGFLQMYFHTVNRFSGEEVCTCPQVSVPERFASVPWNSF
NRDMLKALYGFAPISMHCNKSSAVSFEGEWNWQPLPKIISKLEEPTPRCPASRGQSPANP
TVVSIGGSKS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcatgcgcgaggcggcttccatgtatggtacggcagtggct
gtcttcctggtcatcctggtggccgcgctgcagggctcggcaccccccaagagtcccttc
ccctaccgaatacccctggaccccaagaagtccctggaactctcctggaatgtcagctac
acgcaggagaccgtctacttccagctcctggtgcgggagttcaaggctggggtcctgttt
gggatgtcggaccgtggggagctggagaacgctgacttggttgtgctctggacggatggg
gtcaaggactattttggggatgcctggagtgatgagcggggacagatccacctggacccc
cagcaggattaccagctgctgcaggcgcagaggaccccggaaggcctgtgcctgctcttc
aagaggccctttggcacctgtgaccccaaggattacttcatcgaggacggcaccgtccac
ctggtgtacgggatcttggagaagcctttccagtcgctggaggccatcaacatgtcgggg
ctgcagaccggactccagagggtgcaactgctgaagcccaacatctccatcccggctttg
cccttggacgtgcgcaccatggagatccgcgcccagcacgccctgatccctgacaaggag
accacgtactggtgtcacgtcaccgagcttccggctggcttctcccggcaccacatcgtc
atgtacgagcccatcatcaccaagggcaacgaggccctggtccatcacatggaggtcttc
cagtgcgccccccagatcgagagcgtccccccattcagcgggccctgcgactccaagatg
aagcctgaccgtctcacgtactgccgccacgtgctggccgcctgggccctgggtgccaag
gccttttactacccggaggaagtaggccttgcctttgggggccccgggtcctccaggttt
ctccgtctagaagttcactaccacaacccagagaagatccaaggccggaacgactcctcg
ggcatccgcctgtattacacggccacgctccggcgttacgacgcggggatcatggagctg
gggctggtgtacacgcccgtgatggccatccccccacgggagacggcctttgtccttacc
ggctactgcacggacaagtgcaccaacctgacgctgcctccctcagggatccacatcttc
gcctctcagctccacacacacctgactgggagaaaggtggtcaccgtgctggcccgggat
ggccgagagaaggaggttgtgaaccgggatgaccactacagccctcacttccaggagatc
cgcatgttgaagaagatcgtgtctgtgcagcggggggacgtgctcatcacttcctgcacc
tacgacacgggggacaagaagctggccactgtggggggctacgggatcaacgaggagatg
tgcgtcaactacgtgcactactacccccagacacagctggaactgtgcaagagcagcgtg
gagcccggcttcctgcagatgtacttccacacggtgaacaggttcagtggggaggaagtc
tgcacctgccctcaggtgtctgtccctgagcggtttgcttcggttccctggaactccttc
aatcgagacatgctcaaggccctgtacggcttcgcccccatctccatgcactgcaacaag
tcttcagccgtcagcttcgagggtgaatggaattggcagcccctgcccaagatcatctcc
aagctagaagagcccacccctcggtgtccagccagccggggtcagagccccgccaacccc
actgtggtcagcattggtgggagcaaaagttga

DBGET integrated database retrieval system