KEGG   Ailuropoda melanoleuca (giant panda): 100480395Help
Entry
100480395         CDS       T01329                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100480395
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100480395
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100480395
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100480395
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100480395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 145 aa AA seqDB search
MGLQQVWRLMSRFNSFKRTNIILQHLRMSKHTDAVEVLLERKGCAGVITLNRPKFLNALN
LSMIRHIYPQLKNWEQDPETFLIIIKGAGGKAFCAGGDIRAISEAGKANQKIAQDFFREE
YMLNNAIGSCRKPYVALIHGITMGG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcagcaggtgtggaggcttatgtcgaggtttaattcattcaaaaggactaat
atcatactgcaacatttgagaatgtctaagcacacggatgcagtggaagtactgttggaa
agaaaaggttgtgcaggagtgataacactaaacagaccaaagttcctaaatgctctgaac
cttagtatgattcggcacatttatccacagctaaagaattgggaacaagatcctgaaact
ttcctgatcattataaaaggagctggtggaaaggctttctgtgctgggggtgatatcaga
gcgatctctgaagctggaaaggcaaaccagaagatagctcaagatttctttagagaagaa
tatatgctgaacaatgccattggttcttgccggaaaccatatgttgcacttattcatgga
attacaatgggtggg

DBGET integrated database retrieval system